SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 85643.Tmz1t_1097 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  85643.Tmz1t_1097
Domain Number 1 Region: 4-196
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 3.4e-47
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 85643.Tmz1t_1097
Sequence length 204
Comment (Thauera MZ1T)
Sequence
MTITNIAVCGIGGQGVMTATEILAEAALSLGFDVKKTEVAGMSQRGGVVTSHLRFGPQVL
SPQIMPGEADLLVGFEAAEALRWAHMLKPGGIALVNQGRFVPPVVTIGLYDYPEDPIGEM
RKLGLAVFDFDASALALQLGNIRLGNTVMLGAMSDRLPFPADVLRNAVLARFGARKPELL
ELNRQAFELGRAAVAQPAPTPATA
Download sequence
Identical sequences C4ZJC4
85643.Tmz1t_1097 WP_012584846.1.58410 gi|217969519|ref|YP_002354753.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]