SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 85643.Tmz1t_3095 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  85643.Tmz1t_3095
Domain Number 1 Region: 722-926
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 7.19e-16
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.021
Further Details:      
 
Domain Number 2 Region: 46-262
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 0.0000000000001
Family Pyruvate oxidase and decarboxylase Pyr module 0.068
Further Details:      
 
Domain Number 3 Region: 432-609
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 0.0000000000026
Family Pyruvate oxidase and decarboxylase PP module 0.055
Further Details:      
 
Weak hits

Sequence:  85643.Tmz1t_3095
Domain Number - Region: 278-397
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.000565
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 85643.Tmz1t_3095
Sequence length 1180
Comment (Thauera MZ1T)
Sequence
MSSGKQISNTFTQEEGDIHLGGIDAIVRLTLDQVRTDARRGLKTGMFVSGYRGSPVGMLD
AALIKQQKLLVQNHIHFVDGINEDLAATAVWGTQMLHTVGKQKFDGVTGMWYGKAPGVDR
SGDALKHANYTGIAKNGGVLAIAGDDPSCKSSSLCSQSEPMLFHVGIPSLYPGNVQEILD
YGLHGYQMSRLAGVWMGMKIVTNVADGTGTANVSPERLNFVTPDLEFDGKLFTPNMNLGM
NVRVEALEMEQSLYTRRLEVVKRYARANNLNNVVFPNPDAWIGILTAGKTYNDLNQAFLE
MGLDDAALRRYGIRILKMGMLFPMEPTIVREFAQGLEEIFVIEEKRPFLEMFAKQVLYGM
ANAPRIVGKFDEEEKELLPHYGEFESDVIVRALLKRLSRKTRIESAENWLKRLDEIHSRN
KLPTAVRTAWFCSGCPHNSSTQAPDGSIVSAGIGCHTMAMWMGRNVVMGTHMGAEGTQWI
GMAPFTEAQHIFQNMGDGTYAHSGSLAIRYAASTGVNITFKLLRNAHTSMTGGQAIQGEV
PVTNMVSDLLANGVKKIIVTTDDPSRFNGVQLPGGTEVWHRDRIEEAQRELAATPGCTVL
LHDQECAAELRRARSRGKADEPVEVTVINERVCEGCGDCGEKSNCMSVEPVQTEFGRKTR
IHQSSCNKDFSCVKGFCPSFLTITPHPAPAADGAPKKKKGRIPALERELPPPVKKVDDSL
GFGIHVMGIGGTGSVTVVATLARAARLEGKHVIGLDQTGLAQKGGAVISDIKITHAPFKG
SNKISDGRADLYLGFDILNATDPKNLDKCNPERTIAIVSTTQTPTGQMVTNRKALFPATS
GLTGGIDRVTRKEHNVFLDGEALAAGLFGDAMATNNFMVGVAFQAGTIPLRAESIEDAIR
QSGVAVDMSLAAFRWGRMAVVDRAFVEAEVARQKTGGQVVVLNKAPQLSPAARAIVDSIG
ASGEVKRLVEIRVPELIAFQDEAYARRYAEVIKRVVAGEQKAVSSSALAEAAARYLYKLM
AYKDEFEVARLHTDPAFLAELDAQFPHGYSVKYNLAPPLLSKTDPVTGHPQKKQYGEWMF
KAFKRLSGLKRFRGSALDVFGKTEERQTERKLIEEYIQLLDQILARLNPVNHAAAVALAS
VPDEIRGFGHVKEKNLAAARELQAARLKAFNEAQQERQVA
Download sequence
Identical sequences C4KBB7
85643.Tmz1t_3095 gi|237653756|ref|YP_002890070.1| WP_012585810.1.58410

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]