SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 85962.HP1108 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  85962.HP1108
Domain Number 1 Region: 1-186
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 4.84e-45
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 85962.HP1108
Sequence length 186
Comment (Helicobacter pylori 26695)
Sequence
MFQIRWHARAGQGAITGAKGLADVISKTGKEVQAFASYGSAKRGAAMMAYNRVDDEPILN
HERFMQPDYVLVIDPGLVFIENIFANEKEDTTYIITSYLNKEELFEKKPELKTRKVFLVD
CLKISMETLKRPIPNTPMLGALMKVSGMLEIGAFKEAFKKVLGKKLTQEVIDANMLAIQR
AYEEVQ
Download sequence
Identical sequences A0A024BX34 A0A060PZ18 A0A0B2DRT0 A0A1Y3E5Q4 B5Z8A4 D7FCP6 E8QQK7 I9TYM7 I9U9Y5 I9YF75 J0AAN1 J0ATP7 J0MDN3 J0NKS6 J0NPB5 K2JBP3 K2KD33 K2KPG7 K2L7Z1 K2LC54 L8VTW5 M3UNN9 M4ZK43 O25736 Q1CSF8 T5CJT0 U4REJ8 U4X2H7 V6L812
gi|298735892|ref|YP_003728417.1| gi|410502101|ref|YP_006936628.1| 357544.HPAG1_1047 563041.HPG27_1050 85962.HP1108 gi|15645722|ref|NP_207899.1| NP_207899.1.64343 WP_000486467.1.100016 WP_000486467.1.100183 WP_000486467.1.100370 WP_000486467.1.100917 WP_000486467.1.101183 WP_000486467.1.12096 WP_000486467.1.12724 WP_000486467.1.12929 WP_000486467.1.1313 WP_000486467.1.14785 WP_000486467.1.15236 WP_000486467.1.15441 WP_000486467.1.15770 WP_000486467.1.16964 WP_000486467.1.17944 WP_000486467.1.18045 WP_000486467.1.18505 WP_000486467.1.18665 WP_000486467.1.21161 WP_000486467.1.21640 WP_000486467.1.22342 WP_000486467.1.23156 WP_000486467.1.23239 WP_000486467.1.23346 WP_000486467.1.23910 WP_000486467.1.24415 WP_000486467.1.245 WP_000486467.1.25074 WP_000486467.1.25332 WP_000486467.1.26233 WP_000486467.1.26656 WP_000486467.1.26691 WP_000486467.1.26821 WP_000486467.1.27034 WP_000486467.1.27470 WP_000486467.1.28441 WP_000486467.1.28971 WP_000486467.1.30129 WP_000486467.1.32874 WP_000486467.1.32920 WP_000486467.1.32991 WP_000486467.1.33617 WP_000486467.1.33843 WP_000486467.1.33890 WP_000486467.1.34076 WP_000486467.1.34734 WP_000486467.1.34950 WP_000486467.1.35269 WP_000486467.1.3536 WP_000486467.1.3632 WP_000486467.1.36370 WP_000486467.1.37270 WP_000486467.1.37759 WP_000486467.1.38431 WP_000486467.1.3847 WP_000486467.1.3935 WP_000486467.1.399 WP_000486467.1.4068 WP_000486467.1.40796 WP_000486467.1.41526 WP_000486467.1.423 WP_000486467.1.4357 WP_000486467.1.43999 WP_000486467.1.444 WP_000486467.1.45128 WP_000486467.1.45388 WP_000486467.1.45655 WP_000486467.1.45788 WP_000486467.1.46484 WP_000486467.1.46704 WP_000486467.1.47666 WP_000486467.1.48214 WP_000486467.1.48564 WP_000486467.1.4879 WP_000486467.1.49489 WP_000486467.1.50390 WP_000486467.1.50394 WP_000486467.1.51304 WP_000486467.1.51993 WP_000486467.1.53584 WP_000486467.1.53620 WP_000486467.1.53728 WP_000486467.1.54238 WP_000486467.1.54470 WP_000486467.1.56447 WP_000486467.1.56818 WP_000486467.1.5696 WP_000486467.1.56964 WP_000486467.1.57054 WP_000486467.1.57429 WP_000486467.1.58727 WP_000486467.1.58916 WP_000486467.1.59285 WP_000486467.1.61092 WP_000486467.1.6115 WP_000486467.1.63400 WP_000486467.1.64394 WP_000486467.1.64534 WP_000486467.1.65101 WP_000486467.1.65821 WP_000486467.1.65885 WP_000486467.1.66775 WP_000486467.1.66907 WP_000486467.1.6783 WP_000486467.1.6828 WP_000486467.1.70475 WP_000486467.1.71453 WP_000486467.1.71693 WP_000486467.1.71706 WP_000486467.1.72335 WP_000486467.1.73531 WP_000486467.1.73608 WP_000486467.1.74373 WP_000486467.1.74411 WP_000486467.1.7512 WP_000486467.1.75583 WP_000486467.1.75765 WP_000486467.1.76511 WP_000486467.1.76898 WP_000486467.1.76936 WP_000486467.1.76964 WP_000486467.1.77110 WP_000486467.1.77453 WP_000486467.1.78022 WP_000486467.1.78855 WP_000486467.1.79031 WP_000486467.1.79522 WP_000486467.1.81129 WP_000486467.1.81922 WP_000486467.1.82065 WP_000486467.1.82078 WP_000486467.1.82517 WP_000486467.1.83045 WP_000486467.1.83208 WP_000486467.1.84022 WP_000486467.1.84468 WP_000486467.1.84964 WP_000486467.1.85386 WP_000486467.1.85662 WP_000486467.1.85747 WP_000486467.1.87231 WP_000486467.1.87485 WP_000486467.1.88001 WP_000486467.1.88687 WP_000486467.1.88933 WP_000486467.1.8903 WP_000486467.1.90333 WP_000486467.1.92986 WP_000486467.1.93066 WP_000486467.1.93359 WP_000486467.1.94773 WP_000486467.1.95955 WP_000486467.1.96897 WP_000486467.1.97942 WP_000486467.1.98385 WP_000486467.1.98564 WP_000486467.1.98792 WP_000486467.1.98910 WP_000486467.1.990 gi|384897776|ref|YP_005773204.1| APC7050 gi|108563472|ref|YP_627788.1| gi|208435003|ref|YP_002266669.1| gi|15645722|ref|NP_207899.1| gi|410024335|ref|YP_006893588.1| gi|470165469|ref|YP_007537183.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]