SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 882.DVU3025 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  882.DVU3025
Domain Number 1 Region: 787-1183
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 7.36e-137
Family PFOR PP module 0.000000000183
Further Details:      
 
Domain Number 2 Region: 415-667
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.03e-87
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.00000000517
Further Details:      
 
Domain Number 3 Region: 3-258
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.12e-78
Family PFOR Pyr module 0.00000000304
Further Details:      
 
Domain Number 4 Region: 259-411
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 2.14e-47
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.00000178
Further Details:      
 
Domain Number 5 Region: 664-831
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 3.07e-20
Family Ferredoxin domains from multidomain proteins 0.0000969
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 882.DVU3025
Sequence length 1215
Comment (Desulfovibrio vulgaris Hildenborough)
Sequence
MAKKMKTMDGNTATAYVAYALSDTAAIYPITPSSNMGEAADEWAAQGKKNIFGQTVAVRQ
LQSEAGAAGAVHGCLAAGALTSTYTASQGLLLMIPNMYKISGELLPGVFHVSARAIAAHA
LSIFGDHQDVMAARQTGFAMLASTSVQECMDLALVSHLSAIESSVPFCHFFDGFRTSHEL
QKIEVIDYDDMKKLVNWEKVENFRQNAMNPEHPHIRGTAQNPDIYYQAREAANPFYAAVP
GIVASYMKKVGEITGRKYKPFDYVGHPEADRVIIAMGSGCETIEEVVNYLNAAGQRVGLV
KVRLYRPFSVEHLMAVLPASADTITVLDRTKEPGALGEPLYLDVCTAFMERGEMPKLIAG
RYGLGSKEFTPAMVKAVYDNMKVNGPKNHFNVGIIDDVTDTSLEVEADLDTVPTGTVQCK
FFGLGADGTVGANKQAIKIIGDNTDMYAQGYFAYDSKKSGGFTVSHLRFGKSPIQSTYLV
NRADYVACHKSAYVNQYDVLEGIKEGGTFVLNSHWTSVEDMERELPASMRRTIARKQLKF
YNVDAVKVATEVGLGGRINMIMQTAFFKLASVIPFEQAVELLKDSIKKAYGKKGDKIVNM
NIAAVDKAIDALQEVKYPASWADAVDVPVACAEEPGFITDVVRPILAQQGDKLPVSSFEP
DGLFPVGTAAFEKRGVAINVPEWLSENCIQCNQCSFVCPHAAIRPVLATTEELEGAPASF
VTIDAKGKELNGLKYRIQVFAQDCLGCGSCAEVCPAKNKALVMKPIETQLDAQVPNLAFA
EENIAIKDDLMGRDSLKGSQFQQPLMEFSGACAGCGETPYVKLLTQMFGERMIVANATGC
SSIWGASAPTTPYCTNKDGHGPAWGNSLFEDAAEFGYGMGMAFNQRRAKLADLVKEALEL
DIPAELRAAFEGWLAGKDDAEASRKYGDEILALLGTADDHPVLHEMWHMSDLFTKKSVWI
FGGDGWAYDIGYGGVDHVLASGEDINILVMDTEVYSNTGGQSSKATPLGSIAKFAASGKK
TGKKDLGRMAMTYGYVYVASISMGANKQQVLKAFKEAEAYKGPSLIIAYAPCINQGIRKG
MGKSMEEGKLAVESGYWPLYRFNPELADQGKNPFVLESKAPDGTMQDFLAGENRYALLEK
IAPEESKRLRAQIEKEYVERYSMLKQMAEAPAVTAAPGAPVAAAGEAGENCTVSETPEHA
RTNGGSACDDGRSGK
Download sequence
Identical sequences A0A0E0T614 A0A0H3A501 Q726T1
gi|120601398|ref|YP_965798.1| 391774.Dvul_0348 882.DVU3025 gi|387154640|ref|YP_005703576.1| gi|46581428|ref|YP_012236.1| WP_010940284.1.14085 WP_010940284.1.63145 YP_012236.1.77684

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]