SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 883.DvMF_0243 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  883.DvMF_0243
Domain Number 1 Region: 2-145
Classification Level Classification E-value
Superfamily RNase III domain-like 2.27e-48
Family RNase III catalytic domain-like 0.0000399
Further Details:      
 
Domain Number 2 Region: 112-224
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 1.82e-19
Family Double-stranded RNA-binding domain (dsRBD) 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 883.DvMF_0243
Sequence length 230
Comment (Desulfovibrio vulgaris Miyazaki F )
Sequence
MFEKLQSDIHYAFNDAGLLATAMTHSSWANEQQEHVEHNERLEFLGDAVLELCVSEELFA
RFPGAREGDLTRMRARLVSKPALAELARDLQLELYLRLGRGEESQGGRERSSLLSDALEA
MLGAVFLDGGYERARAVVRHVLAARWPCDADGKRSKDYKSRLQELTQSLFRERPVYALMG
SSGPEHEKRFEVRLTLPDGTVFTAIGPSVKRAEQMAAGLALKNLESRSDG
Download sequence
Identical sequences B8DPB3
gi|218885347|ref|YP_002434668.1| 883.DvMF_0243 WP_012611394.1.73305

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]