SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9258.ENSOANP00000014905 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9258.ENSOANP00000014905
Domain Number 1 Region: 160-285
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.56e-38
Family Synaptotagmin-like (S variant) 0.00000926
Further Details:      
 
Domain Number 2 Region: 26-87
Classification Level Classification E-value
Superfamily Cysteine-rich domain 6.13e-19
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.002
Further Details:      
 
Domain Number 3 Region: 97-154
Classification Level Classification E-value
Superfamily Cysteine-rich domain 1.64e-18
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0000435
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9258.ENSOANP00000014905
Sequence length 306
Comment (Ornithorhynchus anatinus)
Sequence
GGMAGLGPGGDPEGAPRPLFCRKGALRQKVIHEVKSHKFTARFFKQPTFCSHCTDFIWGI
GKQGLQCQVCSFVVHRRCHEFVTFECPGAGKGPQTDDPRNKHKFKLHSYSSPTFCDHCGS
LLYGLVHQGMKCSCCEMNVHRRCVRSVPSLCGVDHTERRGRLQLEIQAPGGDELHITVGE
ARNLIPMDPNGLSDPYVKLKLIPDPRNLTKQKTRTVKATLNPVWNETFIFALKPGDLERR
LSVEVWDWDRTSRNDFMGAMSFGVSELLKAPVDGWYKLLNQEEGEYYNVPVADADNCGLL
QKFEVP
Download sequence
Identical sequences 9258.ENSOANP00000014905

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]