SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 93059.P9211_17281 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  93059.P9211_17281
Domain Number - Region: 22-50
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0418
Family NfeD domain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 93059.P9211_17281
Sequence length 61
Comment (Prochlorococcus marinus MIT 9211)
Sequence
MHNSERVILPGSSVVVNDCQSIYNGYKGFVQRITEDRAAVLFEGGNWDKLLTIPIKNLEL
G
Download sequence
Identical sequences A9BD46
WP_012196279.1.78449 gi|159904269|ref|YP_001551613.1| 93059.P9211_17281

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]