SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000040122 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  9544.ENSMMUP00000040122
Domain Number - Region: 1-24
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 0.00311
Family SCAN domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000040122
Sequence length 30
Comment (Macaca mulatta)
Sequence
MLVQEQFQAVLPEELRAQAQRCQPGIRITG
Download sequence
Identical sequences G7MHF4 G7NVT4
ENSMMUP00000040122 ENSMMUP00000040122 9544.ENSMMUP00000040122

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]