SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9598.ENSPTRP00000023084 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9598.ENSPTRP00000023084
Domain Number 1 Region: 102-166
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 2.66e-25
Family SCAN domain 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9598.ENSPTRP00000023084
Sequence length 179
Comment (Pan troglodytes)
Sequence
MAATEPILATTGSPAAVPPEKLEGTGSSSAPERNCVGSSLPEASPPAPEPSSPNAAVPEA
IPTPRAAASAALELPLGPAPVSVAPQAEAEARSTPGPAGSRLGPETFRQRFRQFRYQDAA
GPREAFRQLRELSRQWLRPDIRTKEQIVEMLVQEQLLAILPEAARARRIRRRTDVRITG
Download sequence
Identical sequences A0A2J8JYX9 A1YG31 A2T715
ENSPTRP00000023084 NP_001074949.1.37143 9598.ENSPTRP00000023084 ENSPTRP00000023084

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]