SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9598.ENSPTRP00000030484 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9598.ENSPTRP00000030484
Domain Number 1 Region: 41-133
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 6.41e-40
Family SCAN domain 0.0000398
Further Details:      
 
Domain Number 2 Region: 285-342
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.43e-23
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 3 Region: 247-299
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.58e-21
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 4 Region: 327-379
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.01e-20
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9598.ENSPTRP00000030484
Sequence length 389
Comment (Pan troglodytes)
Sequence
MAITLTLQTAEMQEGLLAVKVKEEEEEHSCGPESGLSRNNPHTREIFRRRFRQFCYQESP
GPREALQRLQELCHQWLRPEMHTKEQILELLVLEQFLTILPEELQAWVRQHRPVSGEEAV
TVLEDLERELDEPGEQVLSHAHEQEEFVKEKATPGAAQESSNDQFQTLEEQLGYNLREVC
PVQEIDGKAGTWNVELAPKREISQEVKSLIQVLGKQNGNITQIPEYGDTCDREGRLEKQR
VSSSVERPYICSECGKSFTQNSILIEHQRTHTGEKPYECDECGRAFSQRSGLFQHQRLHT
GEKRYQCSVCGKAFSQNAGLFHHLRIHTGEKPYQCNQCNKSFSRRSVLIKHQRIHTGERP
YECEECGKNFIYHCNLIQHRKVHPVAESS
Download sequence
Identical sequences H2QSK3
9598.ENSPTRP00000030484 XP_009449019.1.37143 XP_009449021.1.37143 XP_016810599.1.37143 XP_016810600.1.37143 XP_016810601.1.37143 XP_016810602.1.37143 XP_527297.1.37143 ENSPTRP00000030484 ENSPTRP00000030484

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]