SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9606.ENSP00000278319 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9606.ENSP00000278319
Domain Number 1 Region: 42-131
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.46e-35
Family SCAN domain 0.00007
Further Details:      
 
Domain Number 2 Region: 160-209
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.05e-18
Family KRAB domain (Kruppel-associated box) 0.0015
Further Details:      
 
Domain Number 3 Region: 461-512
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.3e-18
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 4 Region: 364-416
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.32e-18
Family Classic zinc finger, C2H2 0.0093
Further Details:      
 
Domain Number 5 Region: 401-447
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000584
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9606.ENSP00000278319
Sequence length 517
Comment (Homo sapiens)
Sequence
MQPLSKLMAISKPRNLSLREQREVLRADMSWQQETNPVVETHDSEASRQKFRHFQYLKVS
GPHEALSQLWELCLQWLRPEIHTKKQIIELLVLEQFLAILPEEVRTWVNLQHPNNSKDMV
TLIEDVIEMLEDEDMPCKDSALQMGSIKEKMKAGSRTGKPQEPVTFKDVVVEFSKEEWGQ
LDSAVKNLYRNVMLENFRNLNSLRKAHLLSKPFESLKLESKKKRWIMEKEIPRKTIFDMK
SISGEESSHGVIMTRLTESGHPSSDAWKGENWLYRNQKKWDINLPQEAFIPETIYTEEED
FECSENKKSFDINSVSSICAIQVGIPSRKGSPKCDKFKTYFKFNLDSVGKQHSEYEYGND
LSLSTDIRHQKSHTTMNSYECYQCGKAFCRSSSLIRHQIIHTGEKPYKCSECGRFFNRRT
NLTKHQKLHAEAKACTSNKCGKAFSKSEDSNNPTLHFGNNFYQCVNCGKSFNRSSSLIRH
QMIHTGEKPFKCKECSKAFNRSSNLVKHQKLHTRDKS
Download sequence
Identical sequences Q9UL58
ENSP00000278319 ENSP00000393202 NP_037382.2.87134 NP_037382.2.92137 XP_006718374.1.92137 gi|93004074|ref|NP_037382.2| ENSP00000393202 ENSP00000278319 ENSP00000393202 9606.ENSP00000278319

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]