SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9615.ENSCAFP00000016955 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9615.ENSCAFP00000016955
Domain Number 1 Region: 35-125
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 5.49e-39
Family SCAN domain 0.0000606
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9615.ENSCAFP00000016955
Sequence length 156
Comment (Canis familiaris)
Sequence
MAATPKPEEQEGLVTIKPEDHAWARDAITANHSPHRRELFRQHFRKLCYQDAPGPREALS
QLWELCRQWLRPEYHTKEQILDLLVLEQFLSILPRDLQAWVQAHHPRTGEEAVTVLEDLE
RELEEPRKQLPATSERQDTLLDKLTPLGRPHESLTT
Download sequence
Identical sequences 9615.ENSCAFP00000016955

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]