SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 96561.Dole_0019 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  96561.Dole_0019
Domain Number 1 Region: 98-155
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000693
Family NfeD domain-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 96561.Dole_0019
Sequence length 158
Comment (Candidatus Desulfococcus oleovorans Hxd3)
Sequence
MNPVMLVVILQLVAVVIIIAEVIIPSGGLLSLLAAGLIGYSLYTVFGQISVDAGYLLIGI
DVVVLPLVILLGLKLLARSPATLRAELSTGAGVTSQRPDMEGLMGKKGTALSDLRPSGVA
MIEGKRVDVVSRGAYIDRNSEVVVRAVTGNQVIVTTPE
Download sequence
Identical sequences A8ZRR2
WP_012173448.1.9016 gi|158520036|ref|YP_001527906.1| 96561.Dole_0019

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]