SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 96561.Dole_0020 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  96561.Dole_0020
Domain Number 1 Region: 11-172
Classification Level Classification E-value
Superfamily ClpP/crotonase 4.97e-18
Family Crotonase-like 0.066
Further Details:      
 
Weak hits

Sequence:  96561.Dole_0020
Domain Number - Region: 423-484
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00235
Family NfeD domain-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 96561.Dole_0020
Sequence length 488
Comment (Candidatus Desulfococcus oleovorans Hxd3)
Sequence
MKRLFLIFCLLVSGFFLVAPGPVSAGDAHTVYVVKVAGDVAPGMAAYLKRALDDIPEAPH
QTIVLDLDTFGGRVDSALMIVDLITAADSKGKTIAFVSRKAISAGALIALACNELVMKPG
TTIGDCAPIMVGSQGPEMLGEKFQSPLRAKFRALAKKNGYPEALAESMVTADMEVFRVVT
KDGGTFYMDALEYEEMDEAQKSAVVSKKTVVAKGELLTMDDIEARDLGFSQMTVSSVKEM
LAAMGIDDTDIVVMEQQWSEGLMRWLGTLAPLLMLIGLGALYTEIKSPGFGVPGIVGIIC
LALFFMNQYAVGLADYTELLIFLLGLVLIGIETFVLPGFGIAGIAGAVCIIVSFVLAMQG
FVLPDPDMPWQTDLMVNNVIQVLGAVVTAFLAALFLLRFVLPRLSAVVSGPYLSATLSEA
RADATANTGAGVGDRGTAATSLRPAGKMKIGPEMYDVVTEGEFLDKGTPVVIIAVRGNVL
VVSRETTQ
Download sequence
Identical sequences A8ZRR3
gi|158520037|ref|YP_001527907.1| 96561.Dole_0020 WP_012173449.1.9016

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]