SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9796.ENSECAP00000021888 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  9796.ENSECAP00000021888
Domain Number - Region: 19-136
Classification Level Classification E-value
Superfamily Viral glycoprotein ectodomain-like 0.034
Family Glycoprotein B-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9796.ENSECAP00000021888
Sequence length 221
Comment (Equus caballus)
Sequence
PRGQQRRVPKARTMQATADSTKMDCVWSNWKSQAIDLLYWRDIKQTGIVFGSFLLLLFSL
TQFSVVSVVAYLALAALSATISFRIYKSVLQAVQKTDEGHPFKAYLELEISLSQEQIQKY
TDCLQLYVNNTLKELRRLFLVQDLVDSLKFAVLMWLLTYVGALFNGLTLLLMAVVSLFTL
PVVYVKHQAQIDQYLGLVRTHINAVVAKIQAKIPGAKRHAE
Download sequence
Identical sequences F6X8N4
ENSECAP00000021888 9796.ENSECAP00000021888 ENSECAP00000021888

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]