SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 99287.STM1651 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99287.STM1651
Domain Number 1 Region: 795-1162
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 7.5e-117
Family PFOR PP module 0.0000000358
Further Details:      
 
Domain Number 2 Region: 419-668
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 5.36e-75
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.00000114
Further Details:      
 
Domain Number 3 Region: 2-254
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.04e-72
Family PFOR Pyr module 0.0000000988
Further Details:      
 
Domain Number 4 Region: 256-411
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 2.14e-43
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.0000221
Further Details:      
 
Domain Number 5 Region: 665-838
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 1.13e-22
Family Ferredoxin domains from multidomain proteins 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 99287.STM1651
Sequence length 1174
Comment (Salmonella typhimurium LT2)
Sequence
MQTIDGNGAVASVAFRTSEVIAIYPITPSSTMAEQADAWAGNGLKNVWGDTPRVVEMQSE
GGAIAAVHGALQTGSLSTSFTSSQGLLLMIPTLYKLAGQLTPFVLHVAARTVATHALSIF
GDHSDVMAVRQTGCAMLCAASVQEAQDFALIAHRATLKSRVPFIHFFDGFRTSHEINKII
PLTNETILNLMPQAEIDAHRARALNPEHPVIRGTSANPDTYFQSREATNPWYNAVYDHVE
EAMKAFGDATGRQYQPFEYYGHPQAERVIIMMGSALGTCEEVVDELLIRGEKVGVLKVRL
FRPFSAKHLLQALPETVRAIAVLDRTKEPGAQAEPLYLDVMTALAEAFNNGERETLPRTI
GGRYGLSSKEFGPACVLAVFNELSRAKPKPRFTVGIYDDVTNLSLPLPENTLPGSAKLEA
LFYGLGSDGSVSATKNNIKIIGNSTPWYAQGYFVYDSKKAGGLTVSHLRVSEKPIRSAYL
IAQADFVGCHQLQFIDKYQMAERLKPGGIFLLNTPYSADEVWSRLPQEVQAVLNQKKARF
YVVNAAKIARECGLGARINTVMQMAFFHLTHILPGDSALVELQGAIAKSYSSKGQDLVER
NWQALALAQESLAEVPLQAVNPHSAHRPPVVSDAAPDFVKTVTAAMLAGLGDALPVSALP
PDGTWPMGTTRWEKRNIAEEIPVWKEELCTQCNHCVAACPHSAIRAKVVSPQAMENAPAS
LHSLDVKSRDMRGQKYVLQVAPEDCTGCNLCVEVCPAKDRQDPQIKAINMMSRLEHVEEE
KVNYDFFLDLPEIERSKLERIDIRTSQLITPLFEYSGACSGCGETPYIKLLTQLYGDRML
IANATGCSSIYGGNLPSTPYTTDANGRGPAWANSLFEDNAEFGLGFRLSVDQHRARVMRL
LAQFADRIPAELNDALHAEATPDVRREQVAALRQHLKSVAGAEELLKDADALVEKSIWLI
GGDGWAYDIGFGGLDHVLSLTENVNILVLDTQCYSNTGGQASKATPLGAVTKFGEHGKRK
ARKDLGVSMMMYGHVYVAQISLGAQLNQTVKAIQEAEAWPGPSLIIAYSPCEEHGYDLAL
SHDQMRQLTATGFWPLYRFDPRRADEGKPPLALDSRPPSDALAETLLNEQRFRRLNAQQP
EVAEQLWRDAALDLQKRYDFLALLAGKAEKPGAD
Download sequence
Identical sequences A0A0D6G069 A0A0F6B1S9 A0A0F7J8W3 A0A0H3NH05 A0A0U1F877 A0A0W3RLZ8 A0A249UYD8 A0A2D3AQ03 A0A2H9YKR8 E8XJY1 Q8ZP89
NP_460610.1.58477 WP_001193265.1.100010 WP_001193265.1.100234 WP_001193265.1.100258 WP_001193265.1.100376 WP_001193265.1.100424 WP_001193265.1.100436 WP_001193265.1.100484 WP_001193265.1.100488 WP_001193265.1.100597 WP_001193265.1.10076 WP_001193265.1.100781 WP_001193265.1.100793 WP_001193265.1.100869 WP_001193265.1.100871 WP_001193265.1.100882 WP_001193265.1.101007 WP_001193265.1.101020 WP_001193265.1.101074 WP_001193265.1.101078 WP_001193265.1.101180 WP_001193265.1.101259 WP_001193265.1.101284 WP_001193265.1.101291 WP_001193265.1.101320 WP_001193265.1.101353 WP_001193265.1.101386 WP_001193265.1.101404 WP_001193265.1.101420 WP_001193265.1.101589 WP_001193265.1.101734 WP_001193265.1.101878 WP_001193265.1.101953 WP_001193265.1.10220 WP_001193265.1.10266 WP_001193265.1.10429 WP_001193265.1.10439 WP_001193265.1.10678 WP_001193265.1.10753 WP_001193265.1.10992 WP_001193265.1.11000 WP_001193265.1.11024 WP_001193265.1.11031 WP_001193265.1.11098 WP_001193265.1.11168 WP_001193265.1.11190 WP_001193265.1.11295 WP_001193265.1.11455 WP_001193265.1.11458 WP_001193265.1.11518 WP_001193265.1.11532 WP_001193265.1.11543 WP_001193265.1.11763 WP_001193265.1.11772 WP_001193265.1.11897 WP_001193265.1.12025 WP_001193265.1.12114 WP_001193265.1.12351 WP_001193265.1.12370 WP_001193265.1.12546 WP_001193265.1.1264 WP_001193265.1.12728 WP_001193265.1.12879 WP_001193265.1.12936 WP_001193265.1.13027 WP_001193265.1.13106 WP_001193265.1.13130 WP_001193265.1.13334 WP_001193265.1.13414 WP_001193265.1.13488 WP_001193265.1.13509 WP_001193265.1.13669 WP_001193265.1.13741 WP_001193265.1.13908 WP_001193265.1.13932 WP_001193265.1.13968 WP_001193265.1.14001 WP_001193265.1.14151 WP_001193265.1.14239 WP_001193265.1.14320 WP_001193265.1.14379 WP_001193265.1.14410 WP_001193265.1.14466 WP_001193265.1.14524 WP_001193265.1.14554 WP_001193265.1.14725 WP_001193265.1.14852 WP_001193265.1.1489 WP_001193265.1.14932 WP_001193265.1.15055 WP_001193265.1.15124 WP_001193265.1.15223 WP_001193265.1.15226 WP_001193265.1.15316 WP_001193265.1.15369 WP_001193265.1.1540 WP_001193265.1.15508 WP_001193265.1.15830 WP_001193265.1.16062 WP_001193265.1.16063 WP_001193265.1.16103 WP_001193265.1.16233 WP_001193265.1.16284 WP_001193265.1.16328 WP_001193265.1.1635 WP_001193265.1.16468 WP_001193265.1.16614 WP_001193265.1.16650 WP_001193265.1.16686 WP_001193265.1.16691 WP_001193265.1.167 WP_001193265.1.16735 WP_001193265.1.16786 WP_001193265.1.16858 WP_001193265.1.16896 WP_001193265.1.16965 WP_001193265.1.1700 WP_001193265.1.17307 WP_001193265.1.17480 WP_001193265.1.17546 WP_001193265.1.17702 WP_001193265.1.17705 WP_001193265.1.18019 WP_001193265.1.18111 WP_001193265.1.18163 WP_001193265.1.18265 WP_001193265.1.18267 WP_001193265.1.18282 WP_001193265.1.18607 WP_001193265.1.18715 WP_001193265.1.18776 WP_001193265.1.18822 WP_001193265.1.18940 WP_001193265.1.18949 WP_001193265.1.19053 WP_001193265.1.19320 WP_001193265.1.19458 WP_001193265.1.19460 WP_001193265.1.19461 WP_001193265.1.19614 WP_001193265.1.19642 WP_001193265.1.19702 WP_001193265.1.19706 WP_001193265.1.19724 WP_001193265.1.19749 WP_001193265.1.19784 WP_001193265.1.19802 WP_001193265.1.19809 WP_001193265.1.19867 WP_001193265.1.1998 WP_001193265.1.20 WP_001193265.1.2010 WP_001193265.1.20212 WP_001193265.1.20266 WP_001193265.1.20271 WP_001193265.1.20330 WP_001193265.1.20362 WP_001193265.1.20418 WP_001193265.1.20443 WP_001193265.1.20525 WP_001193265.1.2054 WP_001193265.1.20553 WP_001193265.1.20626 WP_001193265.1.20646 WP_001193265.1.20886 WP_001193265.1.20908 WP_001193265.1.21049 WP_001193265.1.21146 WP_001193265.1.21245 WP_001193265.1.21246 WP_001193265.1.21269 WP_001193265.1.21400 WP_001193265.1.21497 WP_001193265.1.21548 WP_001193265.1.21603 WP_001193265.1.21751 WP_001193265.1.21757 WP_001193265.1.22024 WP_001193265.1.2205 WP_001193265.1.22062 WP_001193265.1.22067 WP_001193265.1.2221 WP_001193265.1.22379 WP_001193265.1.22427 WP_001193265.1.2246 WP_001193265.1.22485 WP_001193265.1.22537 WP_001193265.1.22620 WP_001193265.1.22870 WP_001193265.1.22979 WP_001193265.1.23102 WP_001193265.1.23114 WP_001193265.1.2314 WP_001193265.1.23192 WP_001193265.1.23259 WP_001193265.1.23460 WP_001193265.1.23472 WP_001193265.1.23482 WP_001193265.1.23634 WP_001193265.1.23932 WP_001193265.1.24017 WP_001193265.1.24206 WP_001193265.1.24308 WP_001193265.1.24578 WP_001193265.1.24737 WP_001193265.1.24779 WP_001193265.1.25008 WP_001193265.1.25015 WP_001193265.1.25206 WP_001193265.1.25405 WP_001193265.1.25454 WP_001193265.1.25493 WP_001193265.1.25668 WP_001193265.1.25690 WP_001193265.1.2570 WP_001193265.1.25814 WP_001193265.1.25988 WP_001193265.1.26311 WP_001193265.1.26319 WP_001193265.1.26429 WP_001193265.1.26440 WP_001193265.1.26493 WP_001193265.1.26551 WP_001193265.1.26567 WP_001193265.1.27010 WP_001193265.1.27173 WP_001193265.1.27206 WP_001193265.1.27423 WP_001193265.1.27561 WP_001193265.1.2763 WP_001193265.1.27665 WP_001193265.1.27707 WP_001193265.1.27761 WP_001193265.1.2777 WP_001193265.1.28094 WP_001193265.1.28126 WP_001193265.1.28170 WP_001193265.1.28302 WP_001193265.1.2835 WP_001193265.1.28370 WP_001193265.1.28538 WP_001193265.1.28575 WP_001193265.1.28625 WP_001193265.1.28655 WP_001193265.1.28694 WP_001193265.1.2879 WP_001193265.1.2890 WP_001193265.1.28946 WP_001193265.1.29006 WP_001193265.1.29010 WP_001193265.1.2910 WP_001193265.1.29588 WP_001193265.1.29601 WP_001193265.1.29606 WP_001193265.1.29615 WP_001193265.1.29619 WP_001193265.1.29704 WP_001193265.1.29969 WP_001193265.1.30006 WP_001193265.1.30027 WP_001193265.1.30180 WP_001193265.1.30469 WP_001193265.1.30505 WP_001193265.1.30507 WP_001193265.1.30535 WP_001193265.1.30547 WP_001193265.1.30794 WP_001193265.1.30833 WP_001193265.1.30835 WP_001193265.1.30972 WP_001193265.1.31 WP_001193265.1.3113 WP_001193265.1.31185 WP_001193265.1.3119 WP_001193265.1.31190 WP_001193265.1.31195 WP_001193265.1.31196 WP_001193265.1.31219 WP_001193265.1.31281 WP_001193265.1.31504 WP_001193265.1.31515 WP_001193265.1.31578 WP_001193265.1.31658 WP_001193265.1.31854 WP_001193265.1.31940 WP_001193265.1.31967 WP_001193265.1.31972 WP_001193265.1.32192 WP_001193265.1.32206 WP_001193265.1.32408 WP_001193265.1.32438 WP_001193265.1.32515 WP_001193265.1.32527 WP_001193265.1.32660 WP_001193265.1.32702 WP_001193265.1.32714 WP_001193265.1.32786 WP_001193265.1.32804 WP_001193265.1.32860 WP_001193265.1.32907 WP_001193265.1.33030 WP_001193265.1.33127 WP_001193265.1.33143 WP_001193265.1.33248 WP_001193265.1.33261 WP_001193265.1.333 WP_001193265.1.33492 WP_001193265.1.33553 WP_001193265.1.33592 WP_001193265.1.33894 WP_001193265.1.34043 WP_001193265.1.34075 WP_001193265.1.34257 WP_001193265.1.34279 WP_001193265.1.34319 WP_001193265.1.34453 WP_001193265.1.34610 WP_001193265.1.34856 WP_001193265.1.34975 WP_001193265.1.34977 WP_001193265.1.35045 WP_001193265.1.35129 WP_001193265.1.35184 WP_001193265.1.35404 WP_001193265.1.35408 WP_001193265.1.35429 WP_001193265.1.35446 WP_001193265.1.35463 WP_001193265.1.35503 WP_001193265.1.35509 WP_001193265.1.35590 WP_001193265.1.35940 WP_001193265.1.36003 WP_001193265.1.3601 WP_001193265.1.36609 WP_001193265.1.36690 WP_001193265.1.3670 WP_001193265.1.36918 WP_001193265.1.36931 WP_001193265.1.37073 WP_001193265.1.37111 WP_001193265.1.37112 WP_001193265.1.37256 WP_001193265.1.37293 WP_001193265.1.37376 WP_001193265.1.3744 WP_001193265.1.37498 WP_001193265.1.37504 WP_001193265.1.37618 WP_001193265.1.37687 WP_001193265.1.37968 WP_001193265.1.37978 WP_001193265.1.38125 WP_001193265.1.38145 WP_001193265.1.383 WP_001193265.1.3848 WP_001193265.1.38613 WP_001193265.1.38673 WP_001193265.1.3869 WP_001193265.1.38693 WP_001193265.1.38773 WP_001193265.1.38882 WP_001193265.1.38913 WP_001193265.1.39003 WP_001193265.1.39136 WP_001193265.1.39229 WP_001193265.1.39405 WP_001193265.1.39420 WP_001193265.1.39449 WP_001193265.1.39512 WP_001193265.1.39556 WP_001193265.1.39629 WP_001193265.1.39763 WP_001193265.1.39862 WP_001193265.1.39921 WP_001193265.1.39923 WP_001193265.1.40017 WP_001193265.1.40072 WP_001193265.1.40073 WP_001193265.1.4011 WP_001193265.1.40208 WP_001193265.1.40240 WP_001193265.1.40257 WP_001193265.1.40292 WP_001193265.1.40305 WP_001193265.1.40311 WP_001193265.1.40380 WP_001193265.1.40395 WP_001193265.1.40465 WP_001193265.1.40508 WP_001193265.1.40710 WP_001193265.1.4087 WP_001193265.1.40877 WP_001193265.1.41017 WP_001193265.1.41086 WP_001193265.1.41091 WP_001193265.1.41226 WP_001193265.1.41279 WP_001193265.1.41554 WP_001193265.1.41572 WP_001193265.1.41591 WP_001193265.1.41662 WP_001193265.1.41708 WP_001193265.1.41761 WP_001193265.1.41859 WP_001193265.1.41882 WP_001193265.1.41985 WP_001193265.1.42104 WP_001193265.1.42320 WP_001193265.1.42342 WP_001193265.1.42422 WP_001193265.1.4276 WP_001193265.1.42864 WP_001193265.1.4288 WP_001193265.1.43018 WP_001193265.1.43041 WP_001193265.1.43244 WP_001193265.1.43312 WP_001193265.1.43334 WP_001193265.1.43351 WP_001193265.1.43437 WP_001193265.1.43522 WP_001193265.1.43613 WP_001193265.1.43668 WP_001193265.1.44005 WP_001193265.1.44043 WP_001193265.1.44099 WP_001193265.1.44121 WP_001193265.1.44291 WP_001193265.1.44310 WP_001193265.1.44640 WP_001193265.1.4467 WP_001193265.1.44747 WP_001193265.1.4485 WP_001193265.1.44877 WP_001193265.1.44927 WP_001193265.1.44971 WP_001193265.1.45067 WP_001193265.1.45074 WP_001193265.1.45079 WP_001193265.1.45098 WP_001193265.1.45177 WP_001193265.1.45259 WP_001193265.1.45344 WP_001193265.1.45349 WP_001193265.1.45365 WP_001193265.1.45550 WP_001193265.1.45585 WP_001193265.1.45660 WP_001193265.1.45690 WP_001193265.1.45797 WP_001193265.1.458 WP_001193265.1.46011 WP_001193265.1.46069 WP_001193265.1.46173 WP_001193265.1.46174 WP_001193265.1.46187 WP_001193265.1.46303 WP_001193265.1.46595 WP_001193265.1.46675 WP_001193265.1.46693 WP_001193265.1.46930 WP_001193265.1.47057 WP_001193265.1.47214 WP_001193265.1.47429 WP_001193265.1.47448 WP_001193265.1.4747 WP_001193265.1.47472 WP_001193265.1.47478 WP_001193265.1.47621 WP_001193265.1.47799 WP_001193265.1.48242 WP_001193265.1.48253 WP_001193265.1.48367 WP_001193265.1.48377 WP_001193265.1.4853 WP_001193265.1.48788 WP_001193265.1.4885 WP_001193265.1.48876 WP_001193265.1.48894 WP_001193265.1.48919 WP_001193265.1.49084 WP_001193265.1.49155 WP_001193265.1.49204 WP_001193265.1.49239 WP_001193265.1.49256 WP_001193265.1.49290 WP_001193265.1.49366 WP_001193265.1.49490 WP_001193265.1.49515 WP_001193265.1.49572 WP_001193265.1.4979 WP_001193265.1.49803 WP_001193265.1.49805 WP_001193265.1.49929 WP_001193265.1.50080 WP_001193265.1.50161 WP_001193265.1.50211 WP_001193265.1.50376 WP_001193265.1.50389 WP_001193265.1.50676 WP_001193265.1.50774 WP_001193265.1.50804 WP_001193265.1.50808 WP_001193265.1.5088 WP_001193265.1.50908 WP_001193265.1.50941 WP_001193265.1.51014 WP_001193265.1.51022 WP_001193265.1.51179 WP_001193265.1.51182 WP_001193265.1.51186 WP_001193265.1.51487 WP_001193265.1.51488 WP_001193265.1.51634 WP_001193265.1.51649 WP_001193265.1.51686 WP_001193265.1.51756 WP_001193265.1.51911 WP_001193265.1.51932 WP_001193265.1.51989 WP_001193265.1.52121 WP_001193265.1.52148 WP_001193265.1.52346 WP_001193265.1.52361 WP_001193265.1.52653 WP_001193265.1.52656 WP_001193265.1.52743 WP_001193265.1.52857 WP_001193265.1.52898 WP_001193265.1.52915 WP_001193265.1.53190 WP_001193265.1.53406 WP_001193265.1.53436 WP_001193265.1.53466 WP_001193265.1.53529 WP_001193265.1.53543 WP_001193265.1.53757 WP_001193265.1.53812 WP_001193265.1.54033 WP_001193265.1.54075 WP_001193265.1.54196 WP_001193265.1.542 WP_001193265.1.54209 WP_001193265.1.54271 WP_001193265.1.54273 WP_001193265.1.54274 WP_001193265.1.54319 WP_001193265.1.54364 WP_001193265.1.54400 WP_001193265.1.54644 WP_001193265.1.54662 WP_001193265.1.54722 WP_001193265.1.54749 WP_001193265.1.54764 WP_001193265.1.55008 WP_001193265.1.55152 WP_001193265.1.55156 WP_001193265.1.55285 WP_001193265.1.55475 WP_001193265.1.55647 WP_001193265.1.55743 WP_001193265.1.55768 WP_001193265.1.55782 WP_001193265.1.55993 WP_001193265.1.56002 WP_001193265.1.56012 WP_001193265.1.56105 WP_001193265.1.56238 WP_001193265.1.56286 WP_001193265.1.56304 WP_001193265.1.56414 WP_001193265.1.56438 WP_001193265.1.56597 WP_001193265.1.56601 WP_001193265.1.56614 WP_001193265.1.56671 WP_001193265.1.56682 WP_001193265.1.56875 WP_001193265.1.56877 WP_001193265.1.57168 WP_001193265.1.57187 WP_001193265.1.57232 WP_001193265.1.57377 WP_001193265.1.57418 WP_001193265.1.57433 WP_001193265.1.57515 WP_001193265.1.57529 WP_001193265.1.57576 WP_001193265.1.57601 WP_001193265.1.57607 WP_001193265.1.57763 WP_001193265.1.57862 WP_001193265.1.57890 WP_001193265.1.57891 WP_001193265.1.57978 WP_001193265.1.5801 WP_001193265.1.58041 WP_001193265.1.5854 WP_001193265.1.58548 WP_001193265.1.5858 WP_001193265.1.58662 WP_001193265.1.58669 WP_001193265.1.58745 WP_001193265.1.58803 WP_001193265.1.5886 WP_001193265.1.59094 WP_001193265.1.59321 WP_001193265.1.59375 WP_001193265.1.59458 WP_001193265.1.59490 WP_001193265.1.59508 WP_001193265.1.5953 WP_001193265.1.59684 WP_001193265.1.59694 WP_001193265.1.59771 WP_001193265.1.5979 WP_001193265.1.59953 WP_001193265.1.60008 WP_001193265.1.60021 WP_001193265.1.60069 WP_001193265.1.60140 WP_001193265.1.60155 WP_001193265.1.60285 WP_001193265.1.60379 WP_001193265.1.60464 WP_001193265.1.60874 WP_001193265.1.60941 WP_001193265.1.6114 WP_001193265.1.61232 WP_001193265.1.6129 WP_001193265.1.61296 WP_001193265.1.61345 WP_001193265.1.61417 WP_001193265.1.61574 WP_001193265.1.61609 WP_001193265.1.61712 WP_001193265.1.61714 WP_001193265.1.61730 WP_001193265.1.61857 WP_001193265.1.61918 WP_001193265.1.61952 WP_001193265.1.62007 WP_001193265.1.62025 WP_001193265.1.62204 WP_001193265.1.62304 WP_001193265.1.62364 WP_001193265.1.62374 WP_001193265.1.62403 WP_001193265.1.6253 WP_001193265.1.62570 WP_001193265.1.62853 WP_001193265.1.62903 WP_001193265.1.62910 WP_001193265.1.62955 WP_001193265.1.63063 WP_001193265.1.63181 WP_001193265.1.63203 WP_001193265.1.63256 WP_001193265.1.63290 WP_001193265.1.63382 WP_001193265.1.63432 WP_001193265.1.63479 WP_001193265.1.63577 WP_001193265.1.63664 WP_001193265.1.63718 WP_001193265.1.6375 WP_001193265.1.63757 WP_001193265.1.63834 WP_001193265.1.64046 WP_001193265.1.6423 WP_001193265.1.64244 WP_001193265.1.64403 WP_001193265.1.64649 WP_001193265.1.64702 WP_001193265.1.64757 WP_001193265.1.64781 WP_001193265.1.64831 WP_001193265.1.6489 WP_001193265.1.65018 WP_001193265.1.65028 WP_001193265.1.65171 WP_001193265.1.65248 WP_001193265.1.6535 WP_001193265.1.65474 WP_001193265.1.65572 WP_001193265.1.65633 WP_001193265.1.6565 WP_001193265.1.65696 WP_001193265.1.6575 WP_001193265.1.65782 WP_001193265.1.6630 WP_001193265.1.66314 WP_001193265.1.66358 WP_001193265.1.66362 WP_001193265.1.6638 WP_001193265.1.6640 WP_001193265.1.66600 WP_001193265.1.66698 WP_001193265.1.6680 WP_001193265.1.66834 WP_001193265.1.66901 WP_001193265.1.66962 WP_001193265.1.67037 WP_001193265.1.67045 WP_001193265.1.67181 WP_001193265.1.67268 WP_001193265.1.67347 WP_001193265.1.67552 WP_001193265.1.67682 WP_001193265.1.67829 WP_001193265.1.67887 WP_001193265.1.68073 WP_001193265.1.68201 WP_001193265.1.68206 WP_001193265.1.6827 WP_001193265.1.68275 WP_001193265.1.6849 WP_001193265.1.68547 WP_001193265.1.68589 WP_001193265.1.68655 WP_001193265.1.68656 WP_001193265.1.68778 WP_001193265.1.68787 WP_001193265.1.68894 WP_001193265.1.68928 WP_001193265.1.68975 WP_001193265.1.69006 WP_001193265.1.6913 WP_001193265.1.69146 WP_001193265.1.69255 WP_001193265.1.69397 WP_001193265.1.69564 WP_001193265.1.69644 WP_001193265.1.69704 WP_001193265.1.7021 WP_001193265.1.70241 WP_001193265.1.70269 WP_001193265.1.70289 WP_001193265.1.70447 WP_001193265.1.70485 WP_001193265.1.70643 WP_001193265.1.70683 WP_001193265.1.70883 WP_001193265.1.70922 WP_001193265.1.70948 WP_001193265.1.71010 WP_001193265.1.71116 WP_001193265.1.71146 WP_001193265.1.71165 WP_001193265.1.71188 WP_001193265.1.71202 WP_001193265.1.71243 WP_001193265.1.71306 WP_001193265.1.71337 WP_001193265.1.71378 WP_001193265.1.71401 WP_001193265.1.71691 WP_001193265.1.71702 WP_001193265.1.71750 WP_001193265.1.71845 WP_001193265.1.71881 WP_001193265.1.71908 WP_001193265.1.71952 WP_001193265.1.71973 WP_001193265.1.72105 WP_001193265.1.72203 WP_001193265.1.72372 WP_001193265.1.72594 WP_001193265.1.72871 WP_001193265.1.72975 WP_001193265.1.73062 WP_001193265.1.7315 WP_001193265.1.73200 WP_001193265.1.73377 WP_001193265.1.73481 WP_001193265.1.7356 WP_001193265.1.73561 WP_001193265.1.73581 WP_001193265.1.73617 WP_001193265.1.73667 WP_001193265.1.73753 WP_001193265.1.73758 WP_001193265.1.7387 WP_001193265.1.73924 WP_001193265.1.73926 WP_001193265.1.74029 WP_001193265.1.74181 WP_001193265.1.74191 WP_001193265.1.7433 WP_001193265.1.74410 WP_001193265.1.74529 WP_001193265.1.74545 WP_001193265.1.74745 WP_001193265.1.75129 WP_001193265.1.75187 WP_001193265.1.75288 WP_001193265.1.75334 WP_001193265.1.75362 WP_001193265.1.75385 WP_001193265.1.75392 WP_001193265.1.75760 WP_001193265.1.75764 WP_001193265.1.75828 WP_001193265.1.75837 WP_001193265.1.75874 WP_001193265.1.75945 WP_001193265.1.76020 WP_001193265.1.76252 WP_001193265.1.76445 WP_001193265.1.7660 WP_001193265.1.76673 WP_001193265.1.76706 WP_001193265.1.76721 WP_001193265.1.76756 WP_001193265.1.76760 WP_001193265.1.76875 WP_001193265.1.76880 WP_001193265.1.76899 WP_001193265.1.77038 WP_001193265.1.77047 WP_001193265.1.77080 WP_001193265.1.7712 WP_001193265.1.77180 WP_001193265.1.77244 WP_001193265.1.77292 WP_001193265.1.77349 WP_001193265.1.77514 WP_001193265.1.77529 WP_001193265.1.77549 WP_001193265.1.77692 WP_001193265.1.7782 WP_001193265.1.77898 WP_001193265.1.77918 WP_001193265.1.77960 WP_001193265.1.78076 WP_001193265.1.78096 WP_001193265.1.78100 WP_001193265.1.78110 WP_001193265.1.78383 WP_001193265.1.78407 WP_001193265.1.7861 WP_001193265.1.78618 WP_001193265.1.78673 WP_001193265.1.78802 WP_001193265.1.78830 WP_001193265.1.78871 WP_001193265.1.78874 WP_001193265.1.78918 WP_001193265.1.78930 WP_001193265.1.79151 WP_001193265.1.79167 WP_001193265.1.79335 WP_001193265.1.79462 WP_001193265.1.79472 WP_001193265.1.79490 WP_001193265.1.79495 WP_001193265.1.79529 WP_001193265.1.79570 WP_001193265.1.7964 WP_001193265.1.79659 WP_001193265.1.79668 WP_001193265.1.79708 WP_001193265.1.79845 WP_001193265.1.80077 WP_001193265.1.80137 WP_001193265.1.80182 WP_001193265.1.80296 WP_001193265.1.80366 WP_001193265.1.80780 WP_001193265.1.80831 WP_001193265.1.80850 WP_001193265.1.80881 WP_001193265.1.80939 WP_001193265.1.8096 WP_001193265.1.81037 WP_001193265.1.81069 WP_001193265.1.81149 WP_001193265.1.81175 WP_001193265.1.8119 WP_001193265.1.81354 WP_001193265.1.81410 WP_001193265.1.81425 WP_001193265.1.81750 WP_001193265.1.81785 WP_001193265.1.81902 WP_001193265.1.81974 WP_001193265.1.82337 WP_001193265.1.82479 WP_001193265.1.82503 WP_001193265.1.82515 WP_001193265.1.82676 WP_001193265.1.82761 WP_001193265.1.8282 WP_001193265.1.82944 WP_001193265.1.82956 WP_001193265.1.83092 WP_001193265.1.83163 WP_001193265.1.83305 WP_001193265.1.83365 WP_001193265.1.83413 WP_001193265.1.83491 WP_001193265.1.83523 WP_001193265.1.8354 WP_001193265.1.83721 WP_001193265.1.83760 WP_001193265.1.83995 WP_001193265.1.84103 WP_001193265.1.84283 WP_001193265.1.84392 WP_001193265.1.8441 WP_001193265.1.84532 WP_001193265.1.84659 WP_001193265.1.84693 WP_001193265.1.84899 WP_001193265.1.8497 WP_001193265.1.85040 WP_001193265.1.85134 WP_001193265.1.85178 WP_001193265.1.85180 WP_001193265.1.85190 WP_001193265.1.8533 WP_001193265.1.85481 WP_001193265.1.85483 WP_001193265.1.85541 WP_001193265.1.85615 WP_001193265.1.85617 WP_001193265.1.85663 WP_001193265.1.85671 WP_001193265.1.85672 WP_001193265.1.85855 WP_001193265.1.85886 WP_001193265.1.85900 WP_001193265.1.85904 WP_001193265.1.85976 WP_001193265.1.86306 WP_001193265.1.86356 WP_001193265.1.86450 WP_001193265.1.86469 WP_001193265.1.86580 WP_001193265.1.86588 WP_001193265.1.86661 WP_001193265.1.8672 WP_001193265.1.8678 WP_001193265.1.86810 WP_001193265.1.8684 WP_001193265.1.86895 WP_001193265.1.86906 WP_001193265.1.87095 WP_001193265.1.87323 WP_001193265.1.8736 WP_001193265.1.87552 WP_001193265.1.87779 WP_001193265.1.87945 WP_001193265.1.88019 WP_001193265.1.88073 WP_001193265.1.8809 WP_001193265.1.88291 WP_001193265.1.88293 WP_001193265.1.8837 WP_001193265.1.88393 WP_001193265.1.88703 WP_001193265.1.88792 WP_001193265.1.88902 WP_001193265.1.8891 WP_001193265.1.88981 WP_001193265.1.89008 WP_001193265.1.89116 WP_001193265.1.89138 WP_001193265.1.89304 WP_001193265.1.89512 WP_001193265.1.89527 WP_001193265.1.89570 WP_001193265.1.89604 WP_001193265.1.89622 WP_001193265.1.89659 WP_001193265.1.89902 WP_001193265.1.8996 WP_001193265.1.90097 WP_001193265.1.90252 WP_001193265.1.90417 WP_001193265.1.90453 WP_001193265.1.90458 WP_001193265.1.90557 WP_001193265.1.90585 WP_001193265.1.90641 WP_001193265.1.90734 WP_001193265.1.91003 WP_001193265.1.91069 WP_001193265.1.91278 WP_001193265.1.9131 WP_001193265.1.91512 WP_001193265.1.91564 WP_001193265.1.91628 WP_001193265.1.91655 WP_001193265.1.91724 WP_001193265.1.91732 WP_001193265.1.91788 WP_001193265.1.92060 WP_001193265.1.92093 WP_001193265.1.92108 WP_001193265.1.92171 WP_001193265.1.92183 WP_001193265.1.92208 WP_001193265.1.92268 WP_001193265.1.92310 WP_001193265.1.92318 WP_001193265.1.92482 WP_001193265.1.92531 WP_001193265.1.92562 WP_001193265.1.92669 WP_001193265.1.92671 WP_001193265.1.92738 WP_001193265.1.93086 WP_001193265.1.93136 WP_001193265.1.93155 WP_001193265.1.93275 WP_001193265.1.93365 WP_001193265.1.93376 WP_001193265.1.93543 WP_001193265.1.93650 WP_001193265.1.93656 WP_001193265.1.93662 WP_001193265.1.937 WP_001193265.1.93705 WP_001193265.1.93804 WP_001193265.1.9389 WP_001193265.1.93994 WP_001193265.1.94072 WP_001193265.1.94162 WP_001193265.1.94168 WP_001193265.1.94198 WP_001193265.1.9432 WP_001193265.1.94354 WP_001193265.1.94380 WP_001193265.1.94565 WP_001193265.1.94584 WP_001193265.1.94674 WP_001193265.1.94796 WP_001193265.1.94959 WP_001193265.1.95051 WP_001193265.1.95085 WP_001193265.1.95121 WP_001193265.1.95282 WP_001193265.1.95546 WP_001193265.1.95630 WP_001193265.1.95911 WP_001193265.1.96317 WP_001193265.1.96343 WP_001193265.1.9644 WP_001193265.1.96469 WP_001193265.1.96497 WP_001193265.1.96500 WP_001193265.1.96555 WP_001193265.1.96563 WP_001193265.1.96732 WP_001193265.1.96771 WP_001193265.1.97015 WP_001193265.1.97145 WP_001193265.1.97190 WP_001193265.1.97318 WP_001193265.1.97597 WP_001193265.1.97613 WP_001193265.1.97620 WP_001193265.1.97727 WP_001193265.1.97732 WP_001193265.1.9775 WP_001193265.1.97846 WP_001193265.1.98006 WP_001193265.1.98019 WP_001193265.1.98022 WP_001193265.1.9805 WP_001193265.1.98110 WP_001193265.1.98146 WP_001193265.1.98219 WP_001193265.1.9841 WP_001193265.1.98495 WP_001193265.1.98531 WP_001193265.1.98577 WP_001193265.1.98676 WP_001193265.1.98677 WP_001193265.1.98760 WP_001193265.1.98843 WP_001193265.1.9898 WP_001193265.1.99098 WP_001193265.1.99184 WP_001193265.1.99267 WP_001193265.1.99276 WP_001193265.1.99646 WP_001193265.1.99657 WP_001193265.1.99660 WP_001193265.1.99712 WP_001193265.1.99813 WP_001193265.1.99858 WP_001193265.1.99889 WP_001193265.1.99958 gi|378450203|ref|YP_005237562.1| gi|482903461|ref|YP_007902021.1| ABAM02000001|CDS_2202042-2205566 ABAO01000017|CDS_68004-71528 AE006468|CDS_1742125-1745649 CP001363|CDS_1752102-1755626 FN424405|CDS_1734640-1738164 99287.STM1651 gi|378445064|ref|YP_005232696.1| gi|379700821|ref|YP_005242549.1| gi|525838176|ref|YP_008255147.1| gi|378699531|ref|YP_005181488.1| gi|16764995|ref|NP_460610.1| gi|378984211|ref|YP_005247366.1| gi|383496348|ref|YP_005397037.1| gi|526220280|ref|YP_008265857.1| gi|550901011|ref|YP_008670103.1| gi|378988991|ref|YP_005252155.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]