SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9986.ENSOCUP00000016650 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9986.ENSOCUP00000016650
Domain Number 1 Region: 8-281
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 3.53e-115
Family Capz alpha-1 subunit 0.000000000339
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9986.ENSOCUP00000016650
Sequence length 286
Comment (Oryctolagus cuniculus)
Sequence
MADFEDRVSDEEKVCIAAKFITHAPPGEFNEVFNDVRLLLNNDNLLREGAAHAFAQYNMD
QFTPVKIEGYEDQVLITKHGDLGNSRFLDPRNKISFKFDHLWKEASDPQPEEVDGGLKSW
RESCDSALRAYVKDHYSNGFCAVYAKTIDGQQTIIACIESHQFQPKNFWNSRWRSAWKFT
MTPPIAQVVGVLKIQVHYFEDGNVQLVSHKDVQDSVTVLNEIQTAKEFIKIIENAENEYQ
TAISENYQTMSDTTFKALRRQLPVTRTKVDWNKILSYKIGKEMQNA
Download sequence
Identical sequences 9986.ENSOCUP00000016650 XP_017194668.1.1745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]