SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9986.ENSOCUP00000024605 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9986.ENSOCUP00000024605
Domain Number 1 Region: 45-135
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.51e-38
Family SCAN domain 0.0000426
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9986.ENSOCUP00000024605
Sequence length 140
Comment (Oryctolagus cuniculus)
Sequence
MPARAEPERCRPEARVAGMREELVIVKVEEDPAGGREPEPPGAWPDPETSRQHFRQLSYQ
EVAGPEEALRRLRELCRRWLRPELHSKEQILELLVLEQFLTMLPEELQAWVREHCPESGE
EAAAAVRALQSALDGASPQV
Download sequence
Identical sequences G1U5C6
ENSOCUP00000024605 9986.ENSOCUP00000024605 ENSOCUP00000024605

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]