SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000007667 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000007667
Domain Number 1 Region: 105-213
Classification Level Classification E-value
Superfamily LEA14-like 0.0000915
Family LEA14-like 0.01
Further Details:      
 
Weak hits

Sequence:  99883.ENSTNIP00000007667
Domain Number - Region: 36-65
Classification Level Classification E-value
Superfamily DnaJ/Hsp40 cysteine-rich domain 0.0641
Family DnaJ/Hsp40 cysteine-rich domain 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000007667
Sequence length 264
Comment (Tetraodon nigroviridis)
Sequence
MGKSFSQLTAHSGQEEGRENLSSPLEDSHDEEDGKGGDVSQFPYVEFTGRDSVTCPTCQG
TGRIPRGQENQLVALIPYSDQRLRPRRTKLYVSASVLVCLLLSGLAVFFLFPRSIDVSYV
GVKSVFVSYNKDKRSVYLNITNSLNITNNNYYTVEVANVTAQVQFAKTVIGKSRLSNITA
ISPLDMKQIDYMVPTILGDELNYMYDYCTLQTIKVHNIVVMMQVTVTTTYFGHAEQVSQE
MYQYVDCGGNTTSIRALSLPPPAE
Download sequence
Identical sequences H3CHD9
ENSTNIP00000007667 ENSTNIP00000007667 99883.ENSTNIP00000007667

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]