SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 100226.SCO0580 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  100226.SCO0580
Domain Number 1 Region: 11-333
Classification Level Classification E-value
Superfamily DAK1/DegV-like 1.31e-100
Family DAK1 0.0000018
Further Details:      
 
Domain Number 2 Region: 385-588
Classification Level Classification E-value
Superfamily DhaL-like 4.32e-43
Family DhaL-like 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 100226.SCO0580
Sequence length 593
Comment (Streptomyces coelicolor)
Sequence
MTRLFNDPAAFADEALEGFTAAHRRWVRPVTGGVVRATATPAGQVAVVIGGGSGHYPAFS
GLVGRGLAHGAAVGNVFASPSARQIHSVATAAHGGGGVLLMYGNYAGDVLHFGQAAERLA
ADGIETRTFAVADDISSAGPDESAKRRGIAGDLPVFKAAAAAAEQGLPLEEVLRVAERAG
VRTRSFGIAFSGCTLPGADHPLFTVPEARMAVGLGIHGEPGIGEEALPTADEAALLLVET
LLKELPDDVADPAGRRAAVILNGLGSVKYEELFVVYRKVAALLGDAGVEIVDPEVGELVT
SFDMAGISLTLTWLDDRLEELWRAPADTPAYRKGALGDPEPDQDRAAATAGQDTAAAQDT
AVSDAAASGTTAVPVASDASRRAAGTVLAALDAVARVVDAHAGELGRIDAVAGDGDHGIG
MRRGSSAAHRAAHDAHRVGAGAGTVLTRAADDWADKAGGTSGALWGTILRSLGTALGDRD
APDAARVAEGVTEASAAVRRLGGAEVGDKTMVDVLVPFADALAAATAEGLPLAEAWDRAA
TTATAAAAGTADLLPRRGRARPHAEKSLGTPDAGAHSLALITRAVHGALLDHH
Download sequence
Identical sequences Q9RJR0
100226.SCO0580 gi|21219113|ref|NP_624892.1| NP_624892.1.49638

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]