SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 100226.SCO7323 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  100226.SCO7323
Domain Number 1 Region: 17-127
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.33e-18
Family Anti-sigma factor antagonist SpoIIaa 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 100226.SCO7323
Sequence length 143
Comment (Streptomyces coelicolor)
Sequence
MSQAFPGPHGAPATGHVPVLRLGEVLLVTLQGDLHDSTAQQLQEDLAETIVRSGATGVVI
DVSGVEIVDSFLGRILAEIAGQTGLLAARTVLVGMRPAVAITLVELGLTLPGVHTALSTE
VAMELLRQQAPSSRFGGLRQESQ
Download sequence
Identical sequences Q9KY15
gi|21225598|ref|NP_631377.1| APC65549 100226.SCO7323 NP_631377.1.49638 WP_003971818.1.26049 WP_003971818.1.30910 WP_003971818.1.43399 WP_003971818.1.55229 WP_003971818.1.58943 WP_003971818.1.86682

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]