SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000014546 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000014546
Domain Number 1 Region: 3-141
Classification Level Classification E-value
Superfamily UBC-like 4.61e-40
Family UEV domain 0.000000409
Further Details:      
 
Domain Number 2 Region: 324-384
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 3.79e-21
Family VPS23 C-terminal domain 0.0037
Further Details:      
 
Weak hits

Sequence:  10090.ENSMUSP00000014546
Domain Number - Region: 140-216
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.00366
Family beta-sandwich domain of Sec23/24 0.046
Further Details:      
 
Domain Number - Region: 237-314
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0194
Family FCH domain 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000014546
Sequence length 391
Comment (Mus musculus)
Sequence
MAVSESQLKKMMSKYKYRDLTVRQTVNVIAMYKDLKPVLDSYVFNDGSSRELVNLTGTIP
VRYRGNIYNIPICLWLLDTYPYNPPICFVKPTSSMTIKTGKHVDANGKIYLPYLHDWKHP
RSELLELIQIMIVIFGEEPPVFSRPTVSASYPPYTATGPPNTSYMPGMPSGISAYPSGYP
PNPSGYPGCPYPPAGPYPATTSSQYPSQPPVTTVGPSRDGTISEDTIRASLISAVSDKLR
WRMKEEMDGAQAELNALKRTEEDLKKGHQKLEEMVTRLDQEVAEVDKNIELLKKKDEELS
SALEKMENQSENNDIDEVIIPTAPLYKQILNLYAEENAIEDTIFYLGEALRRGVIDLDVF
LKHVRLLSRKQFQLRALMQKARKTAGLSDLY
Download sequence
Identical sequences Q3UCW0 Q61187
10090.ENSMUSP00000014546 ENSMUSP00000014546 NP_068684.1.92730 ENSMUSP00000014546 ENSMUSP00000014546

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]