SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000037782 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000037782
Domain Number 1 Region: 832-964
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.96e-17
Family cAMP-binding domain 0.011
Further Details:      
 
Domain Number 2 Region: 578-692
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000667
Family Voltage-gated potassium channels 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000037782
Sequence length 1120
Comment (Mus musculus)
Sequence
MHLKDFPIPLPVILFLIGCCFEILSFASTQIQIYADAIQWMDPDIFFGIFTPVIIFNVAF
DMDIYMLQKLFWQILVITIPGFLINYTLILWYLQSVNKLSLKTVPWLLFSAVLISSDPML
TSASIRDLGLSRSLTNLINGESLLTSVLSLVIYSGVVHIRFKSKSVNHTLAHKVMSTAWS
YIVESFITGIVFTKVIQLWMATIFGDDVNHITLIFSVLYLIFYVCELVGMSGIFTLATIG
LFLNSTSFKPGVEAFLLEFWNCLSFIGFLMVFTFIGLLIPAHTYLHISFSDVYYSLNIYF
TLIVLRLLVFLLMSPILSRLGHGFSWRWAFIMVWSEMKGTPNINMALLLAYSDISLGSER
ERSQILFHGVSVCVITLIVNRFILPMAVTKLGLRDVTSTKYKSVYYTFQHFQELTKSTAM
ALKFDKDLANADWNMVDNAIILQNPYAMNQEEITEHQKVKCPDCNKEIDETLNIEAMELT
NRRLLSAQIASYQRQYRNEVLSQSAVQVLVGAAGSFGEKKGEYMSPENIKNFSESKKLLS
FLRKLLLNWVYNTKKDKGVPSRYMFLHACHRIVFTNEFEYTGYLVVLMSTYPMIICWISR
LKDIYDNEIKCANYYFLAFYILEALLKVAAMRKEFFSHTWLLFELGITLVGVLDIILIET
DSISYNFDLTETVVFMNVIRLLRILRILKLVTPKLLQIIDKRMSQQISFRYSILKGYVQG
EMDVLNIIDQIASSKQTKQILLKRVMRNMEHAMKELGYLEYDHPEIAVTMKTKEEINVML
NMAREIVKAFRSKGIIHKVEGTEINKLIMAKKIQVLDLQSVIQPFNVEEAPCNIPWLSED
PEAITFIQEKAKVVTFDCGNNIFEEGDEPEGIYVIISGMVKLKRSKPHLEMERVSAESEI
KIHPLPHTEYLLSGEIIGELNCLTKERMQYSATCKTVVETYFIPISHLYEGFEKRCPNMK
HKMWQKIGLAITAQKIREHLSFEDWNYKLQLKLCNAFIRDIPKSMKTDIYDETVTHVVLI
HGSAEDCQLRKIYKAPFLIPVTCHQIQGMEDFTKVMIIQTSIAVRKFRWNVRKYIPPRRI
SMKPDSERESFETLDETSEEDNGKKENQENEELIEENINI
Download sequence
Identical sequences 10090.ENSMUSP00000037782

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]