SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000055091 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000055091
Domain Number 1 Region: 270-361,388-514
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.71e-54
Family Voltage-gated potassium channels 0.001
Further Details:      
 
Domain Number 2 Region: 107-218
Classification Level Classification E-value
Superfamily POZ domain 1.73e-25
Family Tetramerization domain of potassium channels 0.00092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000055091
Sequence length 562
Comment (Mus musculus)
Sequence
MLKQSNERRWSLSYKPWSTPETEDVPNTGSNQHRRSICSLGARTGSQASIAPQWTEGNYN
YYIEEDEDCGEEGEDWKDDLAEENQKAECLTSLLDGHNDTPAQMSTLKVNVGGHSYLLEC
CELANYPKTRLGRLATSTTRRGQLGLCDDYEAQTDEYFFDRDPAVFQLIYNFYTSGVLLV
RDELCPRSFLEELGYWGVRLKYTPRCCRICFEERRDELSEQLKIQRELRAQAQAEEAEEL
FRDMRFYGPQRQRLWNLMEKPFSSVAAKAMGVATNLFVLISVVALALNTVEEMQHQAEQG
TGGGDPRPILEHVEMLCVAFFTLEFLLRLASTPNLQRFARSALNLVDLVAILPFYLQLLL
ECFTSEDQRHNKDSPREHDLETVGRVGKVGQVLRIMRLMRIFRILKLARHSTGLRAFGFT
LRQCYQQVGCLMLFITMGIFSFSAAVYSVEHDVPGTNFTSILHAWWWAAVSISTVGYGDM
YPETHLGRLFAFLCIAFGIILNGMPISILYNKFSDYYSKLKAYEYTAIRRERGKVNFMQR
ATKKMAECLSESHAQSTTRQEN
Download sequence
Identical sequences Q8CFS6
NP_899002.1.92730 ENSMUSP00000055091 ENSMUSP00000055091 10090.ENSMUSP00000055091 ENSMUSP00000055091

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]