SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000069228 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000069228
Domain Number 1 Region: 144-218
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 3.53e-30
Family AN1-like Zinc finger 0.0000737
Further Details:      
 
Domain Number 2 Region: 13-62
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000000157
Family A20-like zinc finger 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000069228
Sequence length 223
Comment (Mus musculus)
Sequence
MAQETNHSQAPMLCSTGCGFYGNPRTNGMCSVCYKEHLQRQNSSNGRISPPAASVSSLSE
SLPVQCADGSVPDAQSALDSTSSSMQPGPVSNQSLLSESVAPSQVDSTSVDKAVSETEDL
QGPRAEGLVPLECDPPSSVSDTTQQPSEEQSKSLEKPKQKKNRCFMCRKKVGLTGFECRC
GNVYCGVHRYSDVHNCSYNYKADAAEKIRKENPVVVGEKIQKI
Download sequence
Identical sequences Q6DGF4 Q9DCH6
ENSMUSP00000069228 ENSRNOP00000018098 10090.ENSMUSP00000069228 10116.ENSRNOP00000018098 ENSRNOP00000018098 NP_001007631.1.100692 NP_001007631.1.4139 NP_075361.2.92730 XP_006229561.1.100692 XP_006229562.1.100692 XP_006229564.1.100692 XP_006229566.1.100692 XP_006508168.1.92730 XP_006508169.1.92730 XP_006508170.1.92730 XP_006508171.1.92730 XP_017444432.1.100692 ENSMUSP00000069228 ENSMUSP00000069228 ENSMUSP00000135968

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]