SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000072566 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000072566
Domain Number 1 Region: 52-490
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 4.32e-96
Family L-arabinose binding protein-like 0.0039
Further Details:      
 
Weak hits

Sequence:  10090.ENSMUSP00000072566
Domain Number - Region: 512-550
Classification Level Classification E-value
Superfamily TNF receptor-like 0.01
Family TNF receptor-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000072566
Sequence length 802
Comment (Mus musculus)
Sequence
MFIFMEVFFLLNITLLMANFIDPRCFWRINLDEIMDEYLGLSCAFILAAVQTPIENDYFN
KTLNVLKTTKNHKYALALVFAMDEINRNPDLLPNMSLIIRYTLGRCDGKTVIPTPYLFRK
KKESPIPNYFCNEETMCSYLLTGPHWEVSLGFWKHMNSFLSPRILQLTYGPFHSIFSDDE
QYPYLYQMAPKDTSLALAMVSFILYFSWNWIGLVIPDDDQGNQFLLELKKQSENKEICFA
FVKMISVDDVSFPQNTEMYYNQIVMSSTNVIIIYGETYNFIDLIFRMWEPPILQRIWITT
KQLNFPTRKKDISHGTFYGSLTFLPHHGVISGFKNFVQTWFHLRNTDLYLVMQEWKYFNY
EDSASTCKILKNNSSNASFDWLMEQKFDMTFSENSHNIYNAVHAIAHALHEMNLQQADNQ
AIDNGKGASSHCLKVNSFLRRIYFTNPPGDKVFMKQRVIMHDEYDIVHFVNLSQHLGIKM
KLGKFSPYLPHGRHSHLYVDRIELATGRRKMPSSVCSADCSPGFRRLWKEGMAACCFVCS
PCPENEISNETTVVLCVFVKHHDTPIVKANNRSLSYLLLMSLMSCFLCSFFFIGLPNRAI
CVLQQITFGIVFTMAVSTVLAKTVTVVLAFKVTDPGRRLRNFLVSGTPNYIIPICSLLQC
VLCAIWLAVSPPFVDIDEHTLHGHIIIVCNKGSVTAFYCILGYLACLALGNFSVAFLAKN
LPDTFNEAKFLTFSMLVFCSVWVTFLPVYHSTKGKHMVAVEIFSILASSAGILGCIFVPK
IYIILMRPERNSTQKIREKSYF
Download sequence
Identical sequences F8VQD3
NP_033515.2.92730 ENSMUSP00000072566 10090.ENSMUSP00000072566 ENSMUSP00000072566 ENSMUSP00000072566

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]