SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000000149 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000000149
Domain Number 1 Region: 67-185
Classification Level Classification E-value
Superfamily E set domains 0.000000252
Family ML domain 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000000149
Sequence length 187
Comment (Rattus norvegicus)
Sequence
MSGGGRTSEAFLWDLLIIGHTQSLTMNSVAAALLVWILTSPSSSDHGREKGWPTHMACSS
GGLEVVYQSCDPFQDFGLSIDQCSKQIQPNLNIRFGIILREDIRKLFLDIAFVAKGSSLL
NYSYPLCEEDQPKFSFCGRRKGEQIYYAGPVNNPGLDVPQGEYQLLLELYNENHATVACA
NATVTCS
Download sequence
Identical sequences D3ZAS0
NP_001099598.1.100692 NP_001099598.1.4139 XP_006253862.1.100692 10116.ENSRNOP00000000149 ENSRNOP00000000149 ENSRNOP00000000149

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]