SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000001012 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000001012
Domain Number 1 Region: 65-122
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 5.67e-17
Family Transcriptional factor domain 0.012
Further Details:      
 
Weak hits

Sequence:  10116.ENSRNOP00000001012
Domain Number - Region: 12-41
Classification Level Classification E-value
Superfamily RING/U-box 0.00353
Family RING finger domain, C3HC4 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000001012
Sequence length 123
Comment (Rattus norvegicus)
Sequence
MELARPCSNFQSDLDFCPDCGSVLPLPGVQDTVICPRCGFSIDVRDFGGKVVKTSVVFNK
LGTVIPMSVDEGPESQGPVVDRRCSRCGHEGMAYYTRQMRSADEGQTVFYTCINCKFQEK
EDS
Download sequence
Identical sequences Q6MFY5
NP_001159772.1.100692 NP_001159772.1.4139 NP_998732.1.100692 NP_998732.1.4139 10116.ENSRNOP00000001012 ENSRNOP00000001012 ENSRNOP00000001012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]