SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000001445 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  10116.ENSRNOP00000001445
Domain Number - Region: 106-157
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 0.000209
Family VPS37 C-terminal domain-like 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000001445
Sequence length 285
Comment (Rattus norvegicus)
Sequence
MAGAVSEARFAGLSLMQLHELLEDDAQLGDMVRGMEETQTVQHNKEMTLASNRSLAEGNL
LYQPQLDAQKARLTQKYQELQVLFEAYQIKKTKLDKQSNSASLETLLALLQAEGAKIEED
TENMAEKFLDGELPLDAFIDVYQSKRKLAHIRRVKVEKLQELVLKGQRLPQAGVPLPPRV
PEPSPATALPYPPLEATGLPSVVPRRIPPPPPPVPAGHVATPFTAAMGSGQASAYPGLQC
PPLPPRVGLPSQQGFSTQLVSPYPPALPQRPPPRMAPHQPGFILQ
Download sequence
Identical sequences D3ZU64
ENSRNOP00000001445 NP_001099398.1.100692 NP_001099398.1.4139 ENSRNOP00000001445 10116.ENSRNOP00000001445

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]