SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000013788 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000013788
Domain Number 1 Region: 14-176
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.75e-27
Family Calponin-homology domain, CH-domain 0.0015
Further Details:      
 
Domain Number 2 Region: 627-705
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.58e-21
Family DIX domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000013788
Sequence length 709
Comment (Rattus norvegicus)
Sequence
MLACLTRGNLLDVLQEGFNEQQLQAYVAWVNAQLKKRPSVKPVQDLRQDLRDGVILAYLI
EIVGQLALDSGASVDVTDFFLLQTPFRAAGEKLSGVQLSPSNQQEMKSNVERVLQFVASK
NIRMHQTSAKDIVEGNLKSIMRLVLALAAHFKPGSSRTVSQGRDSRTSVQSHQPHCATAV
AQGAAAALADVCHDVSRSGRDVFRYRQRNASVDEEIENPYWSVRALVQQYEGQQRSPSES
SCSSLTSPSPIHSAKSESIITQSEEKADFVIIPSEGIENRTDETGSPLSRDWRPGSPGTY
LEATWEEQLLEQQEHLEKEMEEAKKMISGLQALLLNGSLPEDEQERPVALCEPGVNPEEQ
LIIIRSRLDQSMEENQDLKKELLKCKQEARNLQGIKDALQQRLTQQDTSVLQLKQELLRA
NMDKDELHNQNVDLQRKLDERNRLLGEYKKDLGQKDRLLQQQQAKLEDALRKLSDASYQQ
VDLERELEQKDVLLAHRVKGDTDEVTNYNSHSSQRNGFVLPVAGRAATTATHRGPQSSDL
QLVRDALRSLRNSFSGHDPQHHTIDSLEQGISSLIERLHVIETQKKQERKVRGRSPRNQA
SSEYRASWPPNSTLPHSQSSPAVSNTCTKVLYFTDRSLTPFMVNIPKRLGEVTLKDFKAA
IDREGSHRYHFKALDPEFGTVKEEVFHDDDAIPGWEGKIVAWVEDHREN
Download sequence
Identical sequences ENSRNOP00000037500 10116.ENSRNOP00000013788

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]