SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000016321 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000016321
Domain Number 1 Region: 326-382
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 0.0000000000324
Family VPS37 C-terminal domain-like 0.013
Further Details:      
 
Domain Number 2 Region: 62-130
Classification Level Classification E-value
Superfamily UBC-like 0.00000000197
Family UBC-related 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000016321
Sequence length 398
Comment (Rattus norvegicus)
Sequence
MSWLFPLTKSASSSAAGSPAGLTSLQQQKQRLIESLRNSHSSIAEIQKDVEYRLPFTVNN
LTININILLPPQFPQEKPVISVYPPIRHHLMDSQGLYVTSPLVSNFTMHSDLGKIIQSLL
DEFWKNPPVLAPTSTTFPYLYSNPGGMPPYPSQGFPFLPSYPPQEAASRSITSLSVADTV
SSSTTSYTAAKPVAPSFGILSSLPLPVPTTESSASINQNGFGYKMPDIPDAFPELSELSV
SQLTDMNEQEEVLLEQFLMLPQLKQIITDKEDLVKSIEELARKNLLLEHSLETKRQAVLD
KYELLIQMKSTFEKKMQRQHELSESCSASALQARLKVAAHEAEEESDNIAEDFLEGKTEI
DDFLNSFKEKRTICHCRRAKEEKLHQVIAMHSQFHAPL
Download sequence
Identical sequences Q4V794
ENSRNOP00000016321 10116.ENSRNOP00000016321 ENSRNOP00000016321 NP_001020038.1.100692 NP_001020038.1.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]