SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000018763 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000018763
Domain Number 1 Region: 5-367
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.99e-111
Family GABA-aminotransferase-like 0.0000000641
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000018763
Sequence length 370
Comment (Rattus norvegicus)
Sequence
MEATKQVVNFGPGPAKLPYSVLLEIQKQLLDYKGLGISVLEMSHRSPDFAKIISNTENLV
RELLAVPNNYKVIFVQGGGTGQFSAVPLNLIGLKAGRCADYVVTGAWSAKAAEEAKKFGT
VNIVHPKLGSYTKIPDPSTWNLNPDASYVYFCANETVHGVEFDFIPDVKGAVLVCDMSSN
FLSRPVDVSKFGVIFAGAQKNVGSAGVTVVIVRDDLLGFALRECPSVLDYKVQAGNNSLY
NTPPCFSIYVMDMVLEWIKNNGGAAAMEKLSSVKSQMIYEIIDNSQGFYVCPVERQNRSR
MNIPFRIGNSKGDEALEKRFLDKAVELNMISLKGHRSVGGIRASLYNAVTTEDVEKLAAF
MKNFLEMHQL
Download sequence
Identical sequences ENSRNOP00000060217 10116.ENSRNOP00000018763

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]