SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000019689 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000019689
Domain Number 1 Region: 191-293
Classification Level Classification E-value
Superfamily Cyclin-like 8.69e-30
Family Transcription factor IIB (TFIIB), core domain 0.0048
Further Details:      
 
Domain Number 2 Region: 4-49
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.0000000000147
Family Transcriptional factor domain 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000019689
Sequence length 686
Comment (Rattus norvegicus)
Sequence
MTGRVCRGCGGTDIELDAARGDAVCTGCGSVLEDNIIVSEVQFVENSGGGSSAVGQFVSL
DGAGKTPTLGGGFHVNLGKESRAQTLQNGILYFILADHGVGQDAGVGAAPHPPPGEPVAT
EPALPGHSLQLLQDGCKQASYPRTENGPCDCCLPLLDMLLDLSDLLQVNVYVLGKTFLLL
ARELCINAPAIDPCLYIPRFAHLLEFGEKNHEVSMTALRLLQRMKRDWMHTGRRPSGLCG
AALLVAARMHDFRRTVKEVISVVKVCESTLRKRLTEFEDTPTSQLTIDEFMKIDLEEECD
PPSYTAGQRKLRMKQLEQVLSKKLEEVEGEISTYQDAIEIELENSRPKAKGALANLSKDG
SGEDATSSPFCEEDTEDEELEAAASHMNKDFYRELLGADGGSEAAEDADGGSRPLALESL
LGPLPTAASLGISDSIRECISSPSGDPKDSSGDGELDLSGIDDLEIDRYILNESEARVKA
ELWMRENAEYLREQKEKEARIAKEKELGIYKEHKPKKSCKRREPILASTAGEAIEKMLEQ
KKISSKINYSVLRDLNSKGGGSPPRDDSQPPEHTSTKKLSRRKRAATRNSADPGTSMGKR
LRPLVSAQPAKKAAVGEALLLNSPALGAEPVKPSAVLVESGPVSYHPEEDADEEDAEEED
GEPCVSALQMMGGNDYGCDGDEDDGY
Download sequence
Identical sequences D4A8W8
10116.ENSRNOP00000019689 ENSRNOP00000019689 ENSRNOP00000019689 NP_001100231.1.100692 NP_001100231.1.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]