SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000021036 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000021036
Domain Number 1 Region: 14-144
Classification Level Classification E-value
Superfamily Cytidine deaminase-like 5.27e-49
Family Cytidine deaminase 0.000000311
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000021036
Sequence length 146
Comment (Rattus norvegicus)
Sequence
MAQERPSCAVEPEHVQRLLLSSREAKKSAYCPYSRFPVGAALLTGDGRIFSGCNVENACY
PLGVCAERTAIQKAISEGYKDFRAIAIASDLQEEFISPCGACRQVMREFGTNWAVYMTKP
DGTFVVRTVQELLPASFGPEDLQKIH
Download sequence
Identical sequences D4AC20
ENSRNOP00000021036 ENSRNOP00000065378 ENSRNOP00000021036 10116.ENSRNOP00000021036 NP_001102158.1.100692 NP_001102158.1.4139 XP_003750114.1.100692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]