SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000022628 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000022628
Domain Number 1 Region: 38-435
Classification Level Classification E-value
Superfamily PLP-dependent transferases 8.62e-128
Family GABA-aminotransferase-like 0.00000000000111
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000022628
Sequence length 439
Comment (Rattus norvegicus)
Sequence
MLSKLASLQTVAALRRGLRTSVASATSVATKKTEQGPPSSEYIFERESKYGAHNYHPLPV
ALERGKGIYMWDVEGRQYFDFLSAYGAVSQGHCHPKIIEAMKSQVDKLTLTSRAFYNNVL
GEYEEYITKLFNYNKVLPMNTGVEAGETACKLARRWGYTVKGIQKYKAKIVFAVGNFWGR
TLSAVSSSTDPTSYDGFGPFMPGFETIPYNDLPALERALQDPNVAAFMVEPIQGEAGVIV
PDPGYLTGVRELCTRHQVLFIADEIQTGLARTGRWLAVDHENVRPDIVLLGKALSGGLYP
VSAVLCDDDIMLTIKPGEHGSTYGGNPLGCRIAIAALEVLEEEHLAENADKMGAILRKEL
MKLPSDVVTAVRGKGLLNAIVIRETKDCDAWKVCLRLRDNGLLAKPTHGDIIRLAPPLVI
KEDEIRESVEIINKTILSF
Download sequence
Identical sequences P04182
ENSRNOP00000022628 NP_071966.1.100692 NP_071966.1.4139 ENSRNOP00000022628 10116.ENSRNOP00000022628

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]