SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000022956 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000022956
Domain Number 1 Region: 165-612
Classification Level Classification E-value
Superfamily Seven-hairpin glycosidases 7.98e-169
Family Class I alpha-1;2-mannosidase, catalytic domain 0.0000000000122
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000022956
Sequence length 625
Comment (Rattus norvegicus)
Sequence
MLVRKVPGFVPASSWGLRLPQKFLFLLFLSGLVTLCFGALFLLPHSSRLKRLFSASRTQQ
PGLEVMAEIAGHHSVSEQEPPPNPAPAAPAPGEDDSGRLVGVLRRKGWLRRTRPTGPREE
GNRVSALRPQEESVRFSFDYNSFRSRLRHPVLGTRTDESQESQSLVRAQREKIKEMMRFS
WQSYRRYAMGKNELRPLTKDGFEGSMFGGLSGATIIDSLDTLYLMELKEEFQEAKAWVQD
SFHLNVSGEASLFEVHIRYIGGLLSAFYLTGEEVFRVKAIKLGEKLLPAFNTPTGIPKGV
VNFKSGSWGWATAGSSSILAEFGSLHLEFLHLTELSGNPIFAEKVRNIRKVFREIDKPFG
LYPNFLSPVSGNWVQHHVSVGGLGDSFYEYLIKSWLMSAKTDMEAKTMYYEALEAIETYL
VNVSPGGLTYIAEWRGGILDHKMGHLACFSGGMIALGAEDAKEDKRAYYRELAAQITRTC
HESYARSDTKLGPEAFWFNSGREAVATQLSESYYILRPEVVESYMYLWRQTHDPIYREWG
WEVVMALEKHCRTEGGFSGIQDVYSSNPNHDNRQQSFFLAETLKYLYLLFSEDDVLSLED
WVFNTEAHPLPVNRSDSSSVAGHRH
Download sequence
Identical sequences 10116.ENSRNOP00000022956 ENSRNOP00000022956

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]