SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000025219 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000025219
Domain Number 1 Region: 84-144
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 0.0000000000000114
Family AN1-like Zinc finger 0.0017
Further Details:      
 
Domain Number 2 Region: 5-49
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 0.000000000353
Family AN1-like Zinc finger 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000025219
Sequence length 257
Comment (Rattus norvegicus)
Sequence
MEFPDLGAHCSEPSCQRLDFLPLKCDACSGIFCADHVAYAHHHCGSAYQKDIQVPVCPLC
NVPVPVARGEPPDRAVGEHIDRDCRSDPAQQKRKIFTNKCERSGCRQREMMKLTCDRCGR
NFCIKHRHPLDHDCSGEGHPTSRAGLAAISRAQGLASTSTVPSPSRTLPSSSSPSRATPQ
LPPRTTSPVIALQNGLSEDEALQRALELSLAEAKPQIPSSQEEEDLALAQALSASEAEYQ
QQQAQSRSLKPSNCSLC
Download sequence
Identical sequences Q4KLG9
ENSRNOP00000025219 NP_001020916.1.100692 NP_001020916.1.4139 ENSRNOP00000025219 10116.ENSRNOP00000025219

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]