SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000031199 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000031199
Domain Number 1 Region: 2-106
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 6.15e-34
Family Calponin-homology domain, CH-domain 0.000048
Further Details:      
 
Domain Number 2 Region: 185-214
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000174
Family LIM domain 0.016
Further Details:      
 
Weak hits

Sequence:  10116.ENSRNOP00000031199
Domain Number - Region: 215-244
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000314
Family LIM domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000031199
Sequence length 1003
Comment (Rattus norvegicus)
Sequence
MAAIKALQEWCRQQCEGYRDVSITNMTTSFRDGLAFCAILHRHRPDLINFNALRKENIYE
NNKLAFQVAEEQLGIPALLDAEDMVALKIPDRLSILTYVSQYYNYFHGRSPIGGMAGMKR
PSSDSTEELSGKKKVPSQPAKLSSPVPTQRLPLSPARTNPVVQRNEGVSERPSPKAAPGT
VGSSVSSICGVCGKHVHLVQRHLADGRLYHRSCFRCKQCSSTLHSGAYRATGEPGVFVCT
HHSSEAVSVSPKLSNLASRQPGGGIADTRPIGVSQKVLETNGEATPLRARTAAWEHAGGN
RAAKGFVQTELTPPATSRVHVGSPAGPRLPMSTVTTTSANSKATTHVTNSSPVGWSSSAQ
SSTGTSGSRPVVSPSALGAHLSVPQGQAASKGVKTQLNSSTDSSSTAPTPAWTSSSSRTQ
QAREKFFHNLCSSSSHASRVPTVVTAPSGKVSPLVNTSTSKVPSATVVTVPTSKASTVVT
APTSKAPTVVTVPISKAPTVVTAPTSKVSTVVTVPTSKASTVVTAPTSKASTVVTVPTGR
GHVVVNTSASKVSGVVDNPAQESSREQALSVLRKALPGLTRAGSQAPSRSSPATSSVLIT
LPKNEVPPKVPSAKLSHSTTQAFSPTPKMEPTAPLSVGSTSWTSVSLQAGKKSPGISPGI
GKTSAVSRPQAEVKGPGPTSQEGQEEGPEGWRARLKPVDKRRWRQARALEQKEPVLAEPR
AGDTPRKASSSSDSSIHITLTPIQQKRTPCLADSGSSLAAPSPPSRRKKLVVPPTLDVSA
DWLQPELKKQDDQTRSCKEKTATWGTRESSAILDNDLVSPDEAVTSPVRLHPNYISQEEL
QRQLQDIERQLDALELRGVELEKRLRAAEGDASEDGLMVDWFRLIHEKQLLLRRESELMY
KSKDQCLEERQLDLQGELRRLMEKPEGLKSPQDRKREQELLNQYVNTVNDRSDIVDNLDE
DRLREQEEDQMLESMIQNLGLQRKKSKSFLSKIWSSKSKSGQT
Download sequence
Identical sequences ENSRNOP00000031199 10116.ENSRNOP00000031199

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]