SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000033649 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000033649
Domain Number 1 Region: 4-107
Classification Level Classification E-value
Superfamily UBC-like 3.23e-21
Family RWD domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000033649
Sequence length 188
Comment (Rattus norvegicus)
Sequence
MGANEDQEMELEALRSIYEGDESFRELSPVSFQYRIGEDGDPKAFLIEISWTETYPQTPP
VISMNAFFNNTISSAVKQSILAKLQEAVEVNLGTAMTYTLFEYAKDNKEQFMENHHPGSS
TTPIANIISVETPSAAPSSKKKDKKEQLSKAQKRKLADKTDHKGELPRGWNWVDVVKHLS
KSGSKDDE
Download sequence
Identical sequences Q569B7
ENSRNOP00000033649 10116.ENSRNOP00000033649 ENSRNOP00000033649 NP_001030166.1.100692 NP_001030166.1.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]