SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000037442 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000037442
Domain Number 1 Region: 12-140
Classification Level Classification E-value
Superfamily UBC-like 2.17e-26
Family UBC-related 0.000000817
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000037442
Sequence length 141
Comment (Rattus norvegicus)
Sequence
RKMAATTGSGVKVPQNFRLLDELEEGQKGVGDRTVSWGLEDDEDMALTRWIGMIIGPPRT
IYENQIHSLPEAPLSVRFVTRVNMSGVSSSNGVVDPRATAVLAKWQNSRSIKVILQELRR
LMMSKENMKLPQPPEGQCYSN
Download sequence
Identical sequences ENSRNOP00000037442 10116.ENSRNOP00000037442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]