SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000041547 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000041547
Domain Number 1 Region: 12-43
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.00000238
Family Transcriptional factor domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000041547
Sequence length 81
Comment (Rattus norvegicus)
Sequence
VESDQTYELSFVGIPFCQECNNMLYLKNCNYQQEADNSCFYINRATHKVDKLTRIVADVS
QELMMLGTEDHLCQKCGYKDS
Download sequence
Identical sequences ENSRNOP00000041547 10116.ENSRNOP00000041547

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]