SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000045235 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000045235
Domain Number 1 Region: 894-1021
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 3.27e-17
Family cAMP-binding domain 0.011
Further Details:      
 
Domain Number 2 Region: 632-746
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000573
Family Voltage-gated potassium channels 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000045235
Sequence length 1177
Comment (Rattus norvegicus)
Sequence
GMEEVFENLTTTHNVKLSNAWLDLLKSVFLSTPQDLPEIILILSLICTIGAFLNMHLKDF
PIPLPVILFLIGCCFEILSFASTQIQLYADAIQWMDPDMFFGIFTPVIIFNVAFDMDIYM
LQKLFWQILLITIPGFMINYTLILWYLQSVNKLSLKTIPWLLFSAVLISSDPMLTSASIR
DLGLSRSLTNLINGESLLTSVISLIIYSAVVQISFKSKHMNHTLAHKVMSTAWSYLVESF
ITGILITKAIQLWMATIFGDDVNHITLIFSVLYLIFYVCELIGMSGIFTLATIGLFLNST
SFKPGVEAFLLEFWNCLSFIGFLMVFTFIGLLIPAHTYLYISFSDVYYSLNIYFTLIVLR
LLVFLLMSPILSRLGHGFSWRWAFIMVWSEMKGTPNINMALLLAYSDVSLGSERERSQIL
FHGVSVCVITLIVNRFILPMAVIKLGLRDVTSTKYKSVYYTFQHFQELTKSTAMALKFDK
DLANADWNMVDKAIILQNPYALNQEETTEHQKVKCPDCNKEIDETLNIEAMELANRRLLS
AQIASYQRQYRNEILSQSAMQVLVGAAGSFGEKKGEYMSPENIKNYSESKKLLSFLRKLL
LNWVYNTKKDKGVPSRYMFLHACHSIVFTNEFEYTGYIAVLMNTYPMIICWISRLKDIYQ
YEIKCANYYFLTFYILEALLKVAAMRKEFFSHTWLLFELGITLVGILDIILIETDSISYK
FDLTETVVFMNVVRLLRILRILKLITPKLLQVIDKRMSQQISFRYAILKGYVQGEMDVLN
IIDQIASSKQAKQILLKRVIRNMDHAMKELGYLEYDHPEIAVTMKTKEEVNVMLNMAREI
VKAFRSKGIIHKVEGAEINKLIMAKKKQVLELQSVIQPLNVEEAPYYIPWLSEDPEAISF
IQEKAKVVTFDCGNNIFEEGDEPEGIYVIISGMVKLKRSKPHLEMDRVSSESEVAQTRSY
TLPHTEYLLSGEIIGELNCLTKERMQYSATCKTVVETYFIPISHLYEGFEKKYPNMKYKM
WQKIGLAITAQKIRENLSFEDWNYKMQLKLCNVFVRDIPKTTKTDIYDETVTHVVLIHGS
AEDCQLRKIYKAPFLIPVTCHQIQGLEEFTKVMIIQTSVAVRKFRWNVKKYNPPRRISMK
PDSTAESLETLNESSEDDEDKKENEENEEYLEDIIDI
Download sequence
Identical sequences ENSRNOP00000045235 10116.ENSRNOP00000045235

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]