SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000058621 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000058621
Domain Number 1 Region: 5-328
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.37e-77
Family AAT-like 0.000000000517
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000058621
Sequence length 330
Comment (Rattus norvegicus)
Sequence
ARASSWWTHVEMEPPDPILGVTEAFKRDTNSKKMNLRVGAYRNDNGKPYMLPNIRKAEVQ
IAGNNLDKEYLPIGGLAEFCKASADLALGENNEVLKSCGFVTVQTVSGTGALRVRVSFLQ
RFFKFSRDVFLPKPSWGTTHPSSDFSRALQDTSKIPEQSVLLLHTCAQNPMGVDLRPEQW
KEMESVVKKKNLFAFFNMACQGFANGDGDKDAWAMWHFIEQGINVCLCQPYAKNMGLYGE
RVGAFTVVCKDVEEAKRVESQLKILIRPLYSNPPLNGAGIVATILTSPDLQKQWSQGVKG
VADRIISISTQLVSNLKKEGLSHNWQHIID
Download sequence
Identical sequences ENSRNOP00000058621 10116.ENSRNOP00000058621

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]