SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000002832 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000002832
Domain Number 1 Region: 151-269
Classification Level Classification E-value
Superfamily C-type lectin-like 4.12e-39
Family Link domain 0.0018
Further Details:      
 
Domain Number 2 Region: 263-366
Classification Level Classification E-value
Superfamily C-type lectin-like 3.09e-29
Family Link domain 0.0037
Further Details:      
 
Domain Number 3 Region: 47-158
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000584
Family V set domains (antibody variable domain-like) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000002832
Sequence length 596
Comment (Cavia porcellus)
Sequence
MGATSVWAMSLLMLLTLLLVAGDQGTLDATVASAKKELHLQKVGSGAVRAALAELVSLPC
LFTLQPRAGVAQDSARVKWTKVRTASGQRQDVPILVAKDNVVRVAKGWQGRVSLPAYPQH
RANATLLLGPLRASDSGLYRCQVVRGIEDEQDLLPLEVTGVVFHYRAARDRYALTFAEAQ
EACRVSSATIAAPRHLQAAFEDGFDNCDAGWLADRTVRYPITQSRPGCYGDRSSLPGVRS
YGRRDPQELYDVYCFARELGGEVFYVGPPRRLTLAGARAQCRRQGAKLASVGQLHLAWHE
GLDQCDPGWLADGSVRYPIQTPRRRCGGPAPGVRTVYRFANRTGFPAPGGRFDAYCFRAH
HPTPQLGDSETPSSGDEAEILSAEGPPGQEQPEVAAPDAQEPLLSSGDEEPLVLAEEQAS
KKTPGATPSRPTEEAWLAPNPSRTALATGTGTSANVYVEVASAGLLPRRRGLNGRHFQQL
EPYAIGPEGTSTLPLPPGPAGNHVEPPSITEPLGSARSGGPWAILTNEVDVLDAGPPGGR
SPPEPWLWPPTEIPPTTSMPSGMPGLRLEDTEAPTAWPVTSDLARAPLESPVSAPS
Download sequence
Identical sequences ENSCPOP00000002832 ENSCPOP00000002832 10141.ENSCPOP00000002832

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]