SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000004397 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000004397
Domain Number 1 Region: 34-169
Classification Level Classification E-value
Superfamily C-type lectin-like 2.1e-39
Family C-type lectin domain 0.000000975
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000004397
Sequence length 171
Comment (Cavia porcellus)
Sequence
MAPYSMSWMLISSLVLLSQVQGEKSEDKVSSPGSNCPKGAKAFGSYCYFLFRTPRSWYNA
DLACQKRPSGHLVSVLSAAEASFVASLIKSVSNTYSYVWIGLHDPTQGNEPDANGWEWSN
DDILDYFNWERNPATATDRGYCGSLSRTSAYLKWRDYNCNTQLPYVCKFRG
Download sequence
Identical sequences ENSCPOP00000004397 ENSCPOP00000004397 10141.ENSCPOP00000004397

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]