SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000008246 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000008246
Domain Number 1 Region: 897-1020
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 3.01e-20
Family cAMP-binding domain 0.024
Further Details:      
 
Domain Number 2 Region: 638-748
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000000526
Family Voltage-gated potassium channels 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000008246
Sequence length 1132
Comment (Cavia porcellus)
Sequence
RTVRNNMDHHSADHSNSSDIFWAFIEHVFLNAPDDLPEVILIVSLICTIGAFLNMHLKVF
LIPLPVILFLLGCCLELLSFASAEVQRYSEAIQWIDPDLFFGIFLPIIMFNVAFDLDVYM
LQKLMWQLLLITIPGFAFNYMLIFWYLKSLNILNLSTIQLSLFSCILMSSDPMITAASIK
DLDIGLSRSLISLINAESVISSVIALILCTTTMDINVRRQHSASHNLYDDIMIAIWTDVI
ASLLFGTFSSKVIQSWTSDFCYDDVNYTIVISAVLYLIYYICKTGEFVRLSGIFTVVSIG
LFLNSTSFKLRIGTFLFEFWDCLSFFAFLMVFTFSGLLIPAHTYLYISFSDIYYSLMIYF
SLLVFRLLLFLLLTPILSRFGLGFSWRWAFIMIWSEMKGVPNINMALLLAYADHTFGSER
EKSQILFHGVAVCLINLIVNNLVLPIVVTKLGLRDAASTKYKSNLHTFQRFQELIKSTAS
TLKFDKDLANSDWNMVEKAIVLQNPFALSQEETTEHEKLKCSSCNTEIDETLTIEAMEMA
NNLLVSAQIASYQRQYRTGILSQNAFLVLVGASECFGEKKGEYINPETIKKYSESKNILG
VFRKLLLNWLYNTKKDKGPLSKNHFLRICHNIVSIDEFEYIGFLAILMNIFPITISWVPV
LNNIYASEIRYAAYFFLLLYIIEAAFKMAAMQKKYFSYSWNIFELTITLFGIIDLILFET
RAVSYNLPVTEIMRTIPLLRVLRLFKLIAPKLLRIIDKKMSHQQSFRYAILKGYIQGEID
AMNIIDEIATSKQVKEMLLKRETKNMPHALKELGYLEYDHPEIAVTMKTKEEIYVILNIS
KEVLKSFETKGIIHKNESALISKLIIDKEKEVHEFQSIIKPLTAEEIPYHIPWLEKNQKY
IECILPKARIVTFDCGNDIFQEADEPKGVYIIVSGMVKLQRTMSDSETDNILLESEEKAY
PIVNADYVLAGEIIGELNCLTDKPMQYSATCKTVVEAYFIPKGILYEAFENYPLIEQKMW
LKIARGVAARKIREHLPFEDWGYTLQLKLNNLYVKDIPRVIKTDIYEENVTYVFLIHGSV
EDCHLRKTYNAPFLIPATCHQVQGIEDFTKVAVIRTSIDMKKSRWHSGKFLP
Download sequence
Identical sequences 10141.ENSCPOP00000008246 ENSCPOP00000008246 ENSCPOP00000008246

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]