SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000010827 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000010827
Domain Number 1 Region: 67-201
Classification Level Classification E-value
Superfamily Band 7/SPFH domain 6.02e-40
Family Band 7/SPFH domain 0.0026
Further Details:      
 
Weak hits

Sequence:  10141.ENSCPOP00000010827
Domain Number - Region: 208-326
Classification Level Classification E-value
Superfamily ALDH-like 0.0134
Family ALDH-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000010827
Sequence length 356
Comment (Cavia porcellus)
Sequence
MLARAARGTGALVLRGFVQASGRAPRRASSGLPRNTVVLFVPQQEAWVVERMGRFHRILE
PGLNILIPVLDRIRYVQSLKEIVINVPEQSAVTLDNVTLQIDGVLYLRIMDPYKASYGVE
DPEYAVTQLAQTTMRSELGKLSLDKVFRERESLNASIVDAINQAADYWGIRCLRYEIKDI
HVPPRVKESMQMQVEAERRKRATVLESEGTRESAINVAEGKKQAQILASEAEKAEQINQA
AGEASAVLAKAKAKAEAIRIMAAALTQHNGDAAASLTVAEQYVSAFSKLAKDSNTVLLPS
NPGDVTSMVAQAMGVYGALTKAQMPRAQNSVSSGSSRDVKGTNANLDEEIDRVKLS
Download sequence
Identical sequences H0VKJ1
ENSCPOP00000010827 10141.ENSCPOP00000010827 XP_003470897.1.53824 ENSCPOP00000010827

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]