SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000011918 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000011918
Domain Number 1 Region: 46-237
Classification Level Classification E-value
Superfamily Cytochrome c 3.58e-75
Family Cytochrome bc1 domain 0.00000000754
Further Details:      
 
Domain Number 2 Region: 238-283
Classification Level Classification E-value
Superfamily Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor 4.45e-16
Family Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000011918
Sequence length 283
Comment (Cavia porcellus)
Sequence
QAVSLSSKSGLSRGRKVMLSALGMLAAGGAGLAVALHSAVSASDLELHPPNYPWSHRGLL
SSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEEEAKALAEEVEVQDGPNEDG
EMFMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPP
TGVSLREGLYFNPYFPGQAIAMAPPIYNEVLEYDDGTPATMSQVAKDVSTFLRWASEPEH
DHRKRMGLKMLMMMGLLLPLIYAMKRHKWSVLKSRKLAYRPPK
Download sequence
Identical sequences 10141.ENSCPOP00000011918 ENSCPOP00000011918 ENSCPOP00000011918

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]