SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000014569 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000014569
Domain Number 1 Region: 9-128
Classification Level Classification E-value
Superfamily Cgl1923-like 0.000000418
Family Cgl1923-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000014569
Sequence length 267
Comment (Cavia porcellus)
Sequence
MFVPCGESDPDFSGCTLVLPAVSVGNVGQLAIDLIISTLNMSKIGYFYTDCLVPMVGNNP
YATAEENSTELSINTEVYSLPSRKLVALQLRSIFIKHTKYKSNSFCEKLLSWVKSSSFTR
VIVLSSSHSYQRNDLQLRSTPFRYLLTPCMQKSVENKIKSLNWQEMEKTPCIPEMSDSDY
CVRIPGGGITRALYEEGCSKEIYMAVLLKFVSEGDNVPDALGLAEYLNEWLQLIKPQSKD
PAPPTLPWKIPSSWKLLFGSGLPPALF
Download sequence
Identical sequences 10141.ENSCPOP00000014569 ENSCPOP00000014569 ENSCPOP00000014569

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]