SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000014774 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000014774
Domain Number 1 Region: 148-173,202-399
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.4e-60
Family Voltage-gated potassium channels 0.00041
Further Details:      
 
Domain Number 2 Region: 19-116
Classification Level Classification E-value
Superfamily POZ domain 2.28e-27
Family Tetramerization domain of potassium channels 0.00000275
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000014774
Sequence length 490
Comment (Cavia porcellus)
Sequence
XEPLQPALPAAGKQGLLRERVVINISGLRFETQLKTLCQFPETLLGDPKRRMRYFDPLRN
EYFFDRNRPSFDAILYYYQSGGRIRRPVNVPIDIFSEEIRFYQLGEEAMEKFREDEGFLR
EEERPLPRRDFQRQVWLLFEYPESSGPARGIAIVSVLVILISIVIFCLETLPEFRDEKDY
PASPSQDAFESASNSTSGPPGGASSFSDPFFVVETLCIIWFSFELLVRFFACPSKATFSR
NIMNLIDIVAIIPYFITLGTELAERQGNGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQ
ILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADDPTSGFSSIPDAFWWAVVTMTTV
GYGDMHPVTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETEGEEQAQYMHVGSC
QHLSSSAEELRKARSNSTLSKSEYMVIEEGGMNHSTFPQTPFKTGNSTATCTTNNNPNSC
VNIKKIFTDV
Download sequence
Identical sequences ENSCPOP00000014774 ENSCPOP00000014774 10141.ENSCPOP00000014774

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]